DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and golg-4

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_001355507.1 Gene:golg-4 WormBaseID:WBGene00010306 Length:1642 Species:Caenorhabditis elegans

Alignment Length:1762 Identity:401/1763 (23%)
Similarity:744/1763 (42%) Gaps:415/1763 (24%)


  Fly     1 MFANLKNKLI--------------EEVKASPSKFQQFANAAQAAVSSSSS-----TTPNSETNTS 46
            ||.||||:|.              |::.|...:::|..|...|...:|:|     |..:.||...
 Worm     1 MFKNLKNRLDNEAGKLKQSAQQYGEQLAAQVGQYRQAMNEQPAGSDASASISKRFTGESGETKAE 65

  Fly    47 NNENFFSITEEDTPQNSPYRIQKLPATSASALRGRSTQSLNGATSRTRKL-------SNSSMASD 104
            |..|       .:.::|...:.::|......|...||:|   .::|.|:.       ||.|..:.
 Worm    66 NPAN-------TSIESSSAIMSEIPEADLLGLGLSSTES---PSNRRRRSPSEDSIHSNESTLAA 120

  Fly   105 VSFRLPTYEAPAVYHLQSDLDETSSEFDDSASTARLDVITKDQLYDAYKKSLDRYHKYRCRYTDL 169
            :...:|...:.|:..:.||.:..:|:    |.:.|   .|.|..|::..|  .|...|:.:|.|.
 Worm   121 LLQSIPNAISSALETIPSDSESVASD----AFSVR---STNDPAYNSRLK--QRLATYKAKYRDA 176

  Fly   170 AKKYKELERDSSKARSVLVETQDKALRRISELREQCTLEQQAKAHL----------EEALRVEMD 224
            ..::.:|..|.:..|.:|..|||:.|:::.:||    ||::..|..          :|.|..:.:
 Worm   177 VHRHNKLVDDVNTTRKLLETTQDECLQKVEKLR----LEKRILAEKLSNSAGNGDGKEELEKKCE 237

  Fly   225 DMSCKMQAYQTKLQLLGENPENITAALERSGQQLESEQLIDLEESIGKSPLSTNGSSGVSDLQRL 289
            |....::..:.|::.|.::.:             |.:|||.::......|              .
 Worm   238 DYKRMLEQCKIKIKSLQQDKK-------------EQQQLITVDNDDSVDP--------------R 275

  Fly   290 LKERDEQLKSVTEKY-EAVRKQEEENVLLLAQTKQAIHTELELKDTEVRKLQEKLKQLESQRESH 353
            ::|.:::::...|:: ..:.:.::::.:.||.||..:|..||.||:|:.:.:.|...||.|....
 Worm   276 IREMEQRIQKTEEEWTNRINESDQQHAINLATTKAEMHAALENKDSEIEQWRRKCATLEQQDADA 340

  Fly   354 NNEVKEQFKKLQATKQEVDAKLMATEHLLNTLKESYAIKEQQVVTLEAQLEAIRVENEQKVKDLQ 418
            |....::.:|:||..:.::::   ...::..|.|:   |.|.|       :|:..|.|:|     
 Worm   341 NQRWSDKVEKVQAMNKALESE---KNEMIEKLSEA---KAQGV-------KAVLEEEERK----- 387

  Fly   419 KQNEDRNTQASDSSEQLKKLQAAVQDAESQLLSKDQLLESLRSEQAAKEQQ-LKHLKEQLGKLKQ 482
                 |....:|.::::::|:...:....::.:....||:..|.:..:|:: ::.||.:|..:|.
 Worm   388 -----RTEMETDLNDEIERLKEETEKMRLEMSTYKVQLEAKESREFDEEREDVEALKLELNAVKS 447

  Fly   483 ENENYLDKLRENKKSSDSQTNEAQDQQKKLQAAK--------------DEAESKLLATEELLHSL 533
            ..::...::.||..|.::..:||   :|.|.|||              ::.|.:..|:|   |..
 Worm   448 TRDDLESRITENSSSFENYRSEA---EKTLAAAKAQFEKMVSECDKWREKYEERAAASE---HIA 506

  Fly   534 RNDYKAQE-----------EKVALLED------KLKTLSKENDVNVEKLHHINEQREAQSTDSQQ 581
            ..:::.||           ||.||.|.      |.:...||.:..|::|..:.::...:....|.
 Worm   507 TVEFETQETDAHRILEFEAEKKALAEKCEELTLKFEQADKEKNEMVQQLSRLQQEMLEKCDALQA 571

  Fly   582 KINELRAAKDEAEAKLLSTEHSLNALQAALSAKEEQAASLEQSLNALKTESEHSLQDL------R 640
            ::||.:|.::|.:||..........:|..|   ||....||....|.:.|.|...::.      :
 Worm   572 EVNEAKALREEIQAKYDDVTQKAERIQGEL---EESKKVLESEKQAFENEKEQEREEQLAKAMEK 633

  Fly   641 LHNDQ--LLEIVQRHQQNDWEAQLARAREELAAIQSQRELHALELEKSLEMERE-SVAALNSEKA 702
            |:::|  |.|:.::.:|::.|...||     .|||   ||    .||..|.|:| |.|....|..
 Worm   634 LNSEQNILDEVTKKLEQSEEEVLAAR-----GAIQ---EL----TEKLEESEKETSTAKTELEAV 686

  Fly   703 SQE-EQHRLKLEQLQREIQILQDQHANSE---SETVAALKGQLEALSQDLA----TSQASLLAKE 759
            |:: :.....|::....|:.::.|..|.|   .|.|..||.:||.:.::::    ..|..|.:..
 Worm   687 SKKLDSSETSLKEFSDMIEAMKIQLINCEKQKDEAVELLKQKLEEVEKNMSDVEVQKQLLLESTT 751

  Fly   760 KELKASGNKLNKIKKQHEQHQA------KSSDQSARLE-ALQSELADRLSH-SRQVESEKEELQA 816
            .|:|........:|||.|:.|:      |.::....|: ||:|:.:..:|. ::|:|:.|:||:|
 Worm   752 SEMKQHAEAAEIVKKQLEEAQSSIENLKKDAENERNLKTALESDESSAISEITKQMEAAKKELEA 816

  Fly   817 RVTGILEEIGTMQAQMQQVQDSHSELEREKRKLESRIESLQQEQVDSSAQDERTSAKLEEIQSEN 881
            ..    :|...::.||.::|..|:..:.:.:||:...| |:..::..|.:||:.:.:....:.||
 Worm   817 SE----KEKSELREQMDRLQKVHNAGQEDIQKLQKTWE-LEMAKIAKSTEDEKLAREQLAGELEN 876

  Fly   882 TKL----------------------AERNC-LLEEQTNHLESQLQAKQDEIGKIQAKLQQVLDEH 923
            .|.                      ||:.. :|:||....:|.|::.| |:...| |..::.:..
 Worm   877 AKEDLKVVEEEKHTGIQRAQGALDDAEKEVKVLKEQLERAQSALESSQ-ELASSQ-KADKIQELE 939

  Fly   924 SKLQNAQELMDHDHRTLQDKCDAYEKDKLLTKHTLDCLQSASEELHRVKANLDRELK-------- 980
            .:|||||:      |:.::...|.|..:.||. ||:...|.:|.|.:....||:||:        
 Worm   940 KELQNAQK------RSSEELETANEMVRSLTA-TLENSNSETEILKQKLETLDKELQARQQTEKA 997

  Fly   981 -------------EQDQQLSELRERQREQEQQLKDQAERCAKLKAQ-------NSESETQLQATI 1025
                         |::||.::::..|.:..|...::.|:...:|.|       :|.:|..|:|.|
 Worm   998 LTEEINVLTTSLAEKEQQTAQIQNLQTQIYQMEVEKEEKVELVKVQLQQAAQSSSSAEEALRAEI 1062

  Fly  1026 SNLREQLDAYKQTEQGIQEKLQATNSSYTTQIATL----EARWSAANSDVERLHEAN----DALQ 1082
            ..|..:|.|.:|.:......|.|.......|:..|    |.:.......:::..:::    .||:
 Worm  1063 EQLEAKLKAVEQAKAEALNSLLAEKEHLQAQLHQLGVEKEEKLEMVKVQLQQAAQSSSSVEQALR 1127

  Fly  1083 LEMEQLKIKHGQEREEVKE-----SIAQKNRQVVELQEAMATRDR--------------QLQEKI 1128
            .|:|:|:.|. ||.||.|:     |:|:|.:|..::||..|...:              |||:..
 Worm  1128 AEIEKLEAKL-QEIEEEKKNALNASLAEKEQQTAQIQELQAQLHQLEVEKEEKLEMVKVQLQQAA 1191

  Fly  1129 EAS-----------EKL-AKFDEILIENEYLNKHTKQLEAELAESAELKEK-------------- 1167
            ::|           ||| ||..|  ||...:...:|: |.::.|.:.|.||              
 Worm  1192 QSSSSVEQALRAEIEKLEAKLQE--IEKAKMQNSSKR-EQKVRELSNLNEKMRVEFIAKEKIISD 1253

  Fly  1168 ----LKSLQCELYVLQEKAEQHAVQMAEKETQSATATAEVSELKKAIEEQAVELTRQKE------ 1222
                |.::..||.|.:...|:..:...|.||:...|||:....|  :||..:..|..||      
 Worm  1254 LRSELSTISTELVVQKATVEKTKMDFGELETREKRATADRENEK--MEEIRLRETFAKELETMGS 1316

  Fly  1223 ----HASFVTEQSDAVQKDLLQAQQQLHDKQIELAMSRDEQA-----LLQAEADGLRQEVICLKE 1278
                ..:...|...:.:|.:.:...|..:|..:...|:||.:     .|:|.|:..:.|      
 Worm  1317 ALEVKETAYNELKASAEKKIAKLTSQFEEKLKKAQNSQDEASESRFKTLEASAEQAKLE------ 1375

  Fly  1279 HLSPSTDSDSLRSLNERL---QRELEDLKHKSAGAE---SNMQQEIEELQANNQQMAERINELET 1337
                  ....||:|.|.|   :.|:|:||.|...||   |:.:.|.|.|:...:::.:||..||.
 Worm  1376 ------SEQKLRALEELLKSSESEIEELKIKEISAEKDRSHWEVEKEMLEGEAKELTDRIEGLEA 1434

  Fly  1338 LRAGIQAQQLLASMAPKNVQ-EAAAAGEKAELESKLKEIMNEVQDVTNRNLFLEQKCENFLILEQ 1401
                 :.::|.|:...|.|: :..|.....||:.::|::.||:.|   :|...:...|....|:.
 Worm  1435 -----EVKKLTAANETKAVKADTDARKVVRELQKEVKQLYNELND---KNQQFDMVQEELTRLKT 1491

  Fly  1402 SNE-----RLKLQN-----------------AKLSRQLDETLV---------------------- 1422
            |.|     :|::|.                 |.|.::||.:|.                      
 Worm  1492 SKETAENGQLQVQKQMDEEDRRSEFSFKEEIASLKQKLDASLTEADDLRMQVSRNEKTPRSNGNA 1556

  Fly  1423 ------SMQ-HSEAVPANTEFEYLRNIMFQYLTGNTN----NETLVKVISAVLKFSPQQAQVALE 1476
                  ||: |..|.||  |.|||||::::|:|...:    :.||.:||..|.:|...|.:..:.
 Worm  1557 STGRTKSMELHGIADPA--EAEYLRNVLYRYMTNRESLGKESVTLARVIGTVARFDESQMKNVIS 1619

  Fly  1477 KEHQRRS 1483
            .|..|::
 Worm  1620 SEESRQA 1626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 208/920 (23%)
Phage_GPO <306..421 CDD:301727 27/115 (23%)
Smc 737..1442 CDD:224117 211/898 (23%)
MIT_CorA-like <1244..>1333 CDD:294313 27/100 (27%)
Grip 1433..1477 CDD:197860 15/48 (31%)
golg-4NP_001355507.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 198 1.000 Inparanoid score I2455
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005529
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126585
Panther 1 1.100 LDO PTHR19327
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5799
TreeFam 00.000 Not matched by this tool.
55.080

Return to query results.
Submit another query.