DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and Cenpf

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_001074832.2 Gene:Cenpf MGIID:1313302 Length:2997 Species:Mus musculus

Alignment Length:1774 Identity:382/1775 (22%)
Similarity:697/1775 (39%) Gaps:467/1775 (26%)


  Fly     4 NLKNKLIEEVKASPSKFQQ-------FAN------------AAQAAVSSSSSTTPNSETNTSN-N 48
            |.||:| |::|.:.:|.||       ||.            ..|...|..::|..:|.:.|.. .
Mouse  1072 NRKNEL-EQLKETFAKEQQEFLTKLAFAEEQNRKLMLELEIEQQTVRSEITNTNKHSMSATDGLR 1135

  Fly    49 ENFFSITEEDTPQNSPYRIQKLPATSASALRGRSTQSLNGATSRTRKLSNSSMASDVSFRLPTYE 113
            :...::.||...|.:                     .::..|....:|...:.....|:.     
Mouse  1136 QECLTLNEEQNEQQN---------------------EVSNLTHENEQLMELTQTKHDSYL----- 1174

  Fly   114 APAVYHLQSDLDETSSEFDDSASTARLDVITKDQLYDAYKK--------------SLDRYHKYRC 164
              ||..:::.:..|..|...|:|..::|:.|||...|:||.              .||:..:...
Mouse  1175 --AVEPVENSVKATEDEIGKSSSQYQMDIDTKDISLDSYKAQLVHLEALVRILEVQLDQSEEENK 1237

  Fly   165 R-YTDLAKKYKELERDS-----SKARSVLVETQDKALRRISELREQCTLEQQAKAHLEEALRVEM 223
            : :.:|....:|||..|     |:||:.|.:. |.|..:...:.::.:..|...|||:       
Mouse  1238 KLHLELQTIREELETKSSQDPQSQARTGLKDC-DTAEEKYVSMLQELSASQNENAHLQ------- 1294

  Fly   224 DDMSCKMQAYQTKLQLLGENPENITAALERSGQQLESEQLIDLEESIGKSPLSTNGSSGVSDLQR 288
                |.:|....||..||:    :...|.....|||||    |.:|  ::...|..|...:::::
Mouse  1295 ----CSLQTAVNKLNELGK----MCDVLRVEKLQLESE----LNDS--RTECITATSQMTAEVEK 1345

  Fly   289 LLKE-----------RDEQLKSVTEKYEAVRKQEEENVLLLAQTKQAIHTELELKDTEVR----K 338
            |:.|           ::|.:|. |...|...|....:|.|..........::.|...|||    :
Mouse  1346 LVSEMKMLNHESALSQNELMKD-TSGGEFHDKANHSSVFLTPLDSSNFCEQMTLSSKEVRVHFAE 1409

  Fly   339 LQEKLKQLESQRESHNNEVKEQFKKLQATKQEVDAKLMATEHLLNTLKESYAIKEQQVVTLEAQL 403
            ||||...|:|:.           |.|.....||.:|:.|....::|||...:.....:.||:..|
Mouse  1410 LQEKFSCLQSEH-----------KILHDQHCEVSSKMSALRSYVDTLKAENSALSMSLRTLQGDL 1463

  Fly   404 EAIRVENEQKV---------------------------KDLQKQNEDR-------NTQA------ 428
            ..   |.|...                           ||:.:|..|.       |..|      
Mouse  1464 VK---EGEPAAEGGHGLPLSFCGADSPSLTNFGETSFYKDVLEQTGDTCHLSLEGNASANSCDLD 1525

  Fly   429 ---SDSSEQ--------------------------LKKLQAAVQDAESQLLSKDQLLESLRSEQA 464
               |.|.|:                          |:.|:...:..|||.:.|::.:|.|....:
Mouse  1526 EEFSSSLEEETLTEKESPPAPGRTVEGLEVLCQVYLQSLKNLEEKTESQRIMKNKEIEKLEQLLS 1590

  Fly   465 AKEQQLKHLKEQLGKLKQENENYLDKLRENKKSSDSQTNEAQDQQK----KLQAAK------DEA 519
            ::.::|..|::|   ...|.|.:..||.......:|:..|.:.|.|    :|:.|:      |.:
Mouse  1591 SERKELSCLRKQ---YLSEKEQWQQKLTSVTLEMESKLAEEKQQTKTLSLELEVARLQLQELDLS 1652

  Fly   520 ESKLLAT--EELLHSLRNDYKAQEEKVALLEDKLKTLSKENDVNVEKLHHINEQREAQSTDSQQK 582
            ...||.|  |.::....::|..:|.:|.:.|...||..::.|...:|             |.||.
Mouse  1653 SRSLLGTDLESVVRCQNDNYDIKESEVYISETTEKTPKQDTDQTCDK-------------DIQQD 1704

  Fly   583 INELRAAKDEAEAKLLSTE------HSLNALQAALSAK----EEQAASLEQSLNAL----KTESE 633
            :. |..:..|:|...|:.|      ...|. :|....|    .|..:.|..|.|.|    ..|.:
Mouse  1705 LG-LETSVTESETTRLTGEGCEEQPPKTNC-EAPAEDKTQDCSECISELCSSSNVLVPMDVLEDQ 1767

  Fly   634 HSLQDLRLHNDQLLEIVQ-RHQQNDWEAQLARAREELAAIQSQRELHALELEKS----LEMERES 693
            .|:|:|:|..|.|.|.:: ..:..||:.::.....|:....|:..|..::|:..    :::|: .
Mouse  1768 GSIQNLQLQKDTLNENLRLLPEVEDWDKKVESLLNEIMEADSKLSLQEVQLKMKIATCIQLEK-I 1831

  Fly   694 VAALNSEKASQEEQHR---------LKLEQLQREIQILQDQHANSESETVAALKGQLEALSQDLA 749
            |..|..|||...|:..         |::|:.:.::....|..||.          .|...::|.|
Mouse  1832 VKDLRKEKADLSEKLESLPCNQEVCLRVERSEEDLGFNLDMGANE----------LLSKSTKDNA 1886

  Fly   750 TSQASLLAKEKELKASGNKLNKIK--KQHEQHQAKSSDQSARLEALQSELADRLSHSRQVESEKE 812
            |:..... |||.|... .:|.:||  |.:.:|...|.:  ..||.:|   |::|...|..||:::
Mouse  1887 TNTEDNY-KEKFLDME-RELTRIKSEKANIEHHILSVE--TNLEVVQ---AEKLCLERDTESKQK 1944

  Fly   813 ---ELQARVTGILEEIGTMQAQMQQVQDSHSELEREKRKLESRIESLQQEQVDS----SAQDERT 870
               :|:..:..::.|...::.::..|......|::..:|::.:||.|:..|.:|    .|.:...
Mouse  1945 VIIDLKEELFTVISERNRLREELDNVSKESKALDQMSKKMKEKIEELESHQRESLRHIGAVESEV 2009

  Fly   871 SAKLEEIQSENTKLAERNCLLEEQTNHLESQLQAKQDE-------IGKIQAKLQQVLDEHSKLQN 928
            ..|.:.||:.:..:.|    |.:...||:.|||..|::       ||:::.::.|:..|...|  
Mouse  2010 KDKADLIQTLSFNVGE----LTKDKAHLQEQLQNLQNDSQELSLAIGELEIQIGQLNKEKESL-- 2068

  Fly   929 AQELMDHDHRTLQDKCDAY-----------EKDKLLTKHTLDCLQSASEELHRVKANLDR----- 977
            .:|..:...:..:.:|:..           ||.:...:     |.||.||:|:::..:::     
Mouse  2069 VKESQNFQIKLTESECEKQTISKALEVALKEKGEFAVQ-----LSSAQEEVHQLRRGIEKLSVRI 2128

  Fly   978 --ELKEQDQQLSELRERQREQEQQLKDQAERCAKLKAQNSESE-------TQLQATISNLREQLD 1033
              :.|:....:::|:|.|||.: .|||..|...:...::.|::       ..|:|.:..|:.|.|
Mouse  2129 EADEKKHLSAVAKLKESQRESD-SLKDTVETLERELERSEENQELAILDSENLKAEVETLKAQKD 2192

  Fly  1034 --------------AYKQTEQGIQEKLQATNSSYTTQIATLEARWSAANSDVERLHEANDALQLE 1084
                          ..:...:.:.::||...|    :::.|:.|.|:    :.||.|..:..:::
Mouse  2193 EMTKSLRIFELDLVTVRTERENLAKQLQEKQS----RVSELDERCSS----LRRLLEEKEQARVQ 2249

  Fly  1085 MEQ--------LKIKHGQEREEV-------------KESIAQKNRQVVELQEAMATRDRQLQEKI 1128
            ||:        |:::..:.||||             ::|:.|...:|..|:.::    |:|:..|
Mouse  2250 MEEDSKSAMLMLQMQLKELREEVAALCNDQETLKAQEQSLDQPGEEVHHLKSSI----RKLKVHI 2310

  Fly  1129 EASEKLAKFDEILIENEYLNKHTKQLEAELAESAE----LKEKLKSLQCELYVLQEKAEQHAVQM 1189
            :|.||               ||...|| :|.||..    ||:::::|:.|| :|.||   :.:..
Mouse  2311 DADEK---------------KHQNILE-QLKESKHHADLLKDRVENLEQEL-ILSEK---NMIFQ 2355

  Fly  1190 AEKETQSATATAEVSELKKAIEEQAVELTRQKEHASFVTEQSDAVQKDLLQAQQQ---------- 1244
            |||      :.||:..||..|:..|..|...:........:::.:.|:|.:.|::          
Mouse  2356 AEK------SKAEIQTLKSEIQRMAQNLQDLQLELISTRSENENLMKELKKEQERVSDLETINSS 2414

  Fly  1245 ----LHDKQIELAMSRDEQ----ALLQAEADGLRQEVI--CLKEHLSPSTDSDSLRSLNERLQRE 1299
                |.||:.|....::|.    .:||.:...|.:.|:  |..:.:| .|...:|.|..:.|:.|
Mouse  2415 IENLLKDKEQEKVQMKEEAKITVEMLQTQLKELNETVVSLCNDQEVS-KTKEQNLGSQVQTLELE 2478

  Fly  1300 ----LEDL---KHKSAGAESNMQQEIEELQANNQQMAERINELETLRAGIQAQ-QLLASMAPKNV 1356
                |:||   |:|....:|::....:|::|..|::.:...|:.||:..:::| ||:..:|....
Mouse  2479 KAQLLQDLGEAKNKYIIFQSSVNALTQEVEAGKQKLEKGEKEIRTLKEQLKSQEQLVCKLAQVEG 2543

  Fly  1357 QEAAAAGEKAELESKLKEIMNEVQDVTNRNLFLEQKCENFLILEQSNERLK-----LQNAKLSRQ 1416
            ::.....:|.||.              |..:.||||.:   :|:..|..|:     |||:..|.:
Mouse  2544 EQQLWQKQKLELR--------------NVTMALEQKVQ---VLQSENNTLQSTYEALQNSHKSLE 2591

  Fly  1417 LDETLVSMQHSEAVP-----ANTEFEYLRNI--MFQYLTG-----NTNNETLVKVISAVLKFSPQ 1469
            .:..|:.::....|.     :..|.|..|.:  |.|..|.     |.....|.:.:. ||:...|
Mouse  2592 SELGLIKLEKVALVERVSTISGKEAELQRELRDMLQKTTQLSEDYNKEKNRLTEEVE-VLREELQ 2655

  Fly  1470 QAQVA-------LEKEHQR 1481
            ..:.|       ||||.||
Mouse  2656 NTKAAHLKSVNQLEKELQR 2674

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 205/990 (21%)
Phage_GPO <306..421 CDD:301727 30/146 (21%)
Smc 737..1442 CDD:224117 181/823 (22%)
MIT_CorA-like <1244..>1333 CDD:294313 25/116 (22%)
Grip 1433..1477 CDD:197860 14/58 (24%)
CenpfNP_001074832.2 CENP-F_N 1..300 CDD:287456
SMC_prok_B 290..1122 CDD:274008 13/51 (25%)
SbcC 915..>1363 CDD:223496 70/342 (20%)
CENP-F_leu_zip 2131..2270 CDD:287450 29/148 (20%)
CENP-F_leu_zip 2313..2449 CDD:287450 38/162 (23%)
CENP-F_C_Rb_bdg 2850..2896 CDD:287463
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126585
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.