DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and CENPF

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:NP_057427.3 Gene:CENPF HGNCID:1857 Length:3114 Species:Homo sapiens

Alignment Length:1713 Identity:374/1714 (22%)
Similarity:690/1714 (40%) Gaps:441/1714 (26%)


  Fly     8 KLIEEVKASPSKFQQFANAAQAA-VSSSSSTTPNS--ETNTSNNENFFSITEEDTPQ--NSPYRI 67
            ||.:|:|...|:.::...|||:| ||.:...||..  .|..:.::.:.....||..:  |.....
Human   113 KLEQELKRCKSELERSQQAAQSADVSLNPCNTPQKIFTTPLTPSQYYSGSKYEDLKEKYNKEVEE 177

  Fly    68 QKLPATSASALRG-RSTQSLNGATSRTRKLSNSSMASDVSFRLPTYEAPAVYHLQSD-------- 123
            :|.......||:. :::|:|..||...|.::....:|.| |.....:.|:  ||.|:        
Human   178 RKRLEAEVKALQAKKASQTLPQATMNHRDIARHQASSSV-FSWQQEKTPS--HLSSNSQRTPIRR 239

  Fly   124 ------------------------LDETSSEFDDSASTARLDVITKDQLYDAYKKSLD---RYHK 161
                                    .|..||.||:|:|...||.: |.|..:...|..:   |...
Human   240 DFSASYFSGEQEVTPSRSTLQIGKRDANSSFFDNSSSPHLLDQL-KAQNQELRNKINELELRLQG 303

  Fly   162 YRCRYTDLAKKYKELERDSSKARSVLVETQDKALRRISE--LREQCTLEQQAKAH--LEEALRVE 222
            :.........|::||:....||:..|:| ::|.|.:..:  :|.....:|.:..:  ||:.|:..
Human   304 HEKEMKGQVNKFQELQLQLEKAKVELIE-KEKVLNKCRDELVRTTAQYDQASTKYTALEQKLKKL 367

  Fly   223 MDDMSCKMQAYQTKLQLLGENPENITAALERSGQQLESE------------QLIDLEESIGKSPL 275
            .:|:||:.|           |.|:...:||:..::.|.|            |.:|.|....|:.|
Human   368 TEDLSCQRQ-----------NAESARCSLEQKIKEKEKEFQEELSRQQRSFQTLDQECIQMKARL 421

  Fly   276 STNGSSGVSDLQRLLKERDEQLKSVTEKYEAVRKQEEENV----LLLAQTKQAIHTELELKDTEV 336
            :       .:||: .|.....|::..:|..:|::|.|.|:    ..|.:.:||.... ::|:.|:
Human   422 T-------QELQQ-AKNMHNVLQAELDKLTSVKQQLENNLEEFKQKLCRAEQAFQAS-QIKENEL 477

  Fly   337 RKLQEKLKQLESQRESHNNE--------------VKEQFKKLQATKQEVDAKLMATEHLLNTLKE 387
            |:..|::|:..:..:||:.:              :|:...:.|...:|:.||..:.|.:|..|:|
Human   478 RRSMEEMKKENNLLKSHSEQKAREVCHLEAELKNIKQCLNQSQNFAEEMKAKNTSQETMLRDLQE 542

  Fly   388 SYAIKEQQVVTLEAQLEAIRVENEQKVKDLQKQNEDRNTQASDSSEQLKKLQAAVQDAESQLLSK 452
            ....:|..:.     ||.:::    .|.||:||.:       .|.:.|||.:..::....:|...
Human   543 KINQQENSLT-----LEKLKL----AVADLEKQRD-------CSQDLLKKREHHIEQLNDKLSKT 591

  Fly   453 DQLLESLRSEQAAKEQQLKHLKEQ---LGKLKQENENYLDKLRENKKSSDSQTNEAQ----DQQK 510
            ::..::|.|....|:::.:.|||:   ....|.|||..|.::...|::..|:.|..:    .||.
Human   592 EKESKALLSALELKKKEYEELKEEKTLFSCWKSENEKLLTQMESEKENLQSKINHLETCLKTQQI 656

  Fly   511 KLQAAKDEAESKLLATEELLHSLRNDYKAQEEKVALLEDKLKTLSKENDVNVEKLHHINEQREAQ 575
            |.....:...:..:..|.|...:||.:...:             ||..:|..:||.::..|::|:
Human   657 KSHEYNERVRTLEMDRENLSVEIRNLHNVLD-------------SKSVEVETQKLAYMELQQKAE 708

  Fly   576 STDS--QQKINELRAAKDEAEAKLLSTEHSLNALQAALSAKEEQAASLEQSLNALKTESEHSLQD 638
            .:|.  |::|..:.....:...::...||.|..|...:..|:.    ..|.|:|   |.| ||:|
Human   709 FSDQKHQKEIENMCLKTSQLTGQVEDLEHKLQLLSNEIMDKDR----CYQDLHA---EYE-SLRD 765

  Fly   639 LRLHNDQLLEIVQRHQQNDWEAQLARAREELAAIQSQRELHALELEKSLEMERESVAALNSEKA- 702
            |....|..|...:.||::            |.|...|..:|            .|.|.:..|:. 
Human   766 LLKSKDASLVTNEDHQRS------------LLAFDQQPAMH------------HSFANIIGEQGS 806

  Fly   703 --SQEEQHRLKLEQLQREIQILQDQHANSESETVAALKGQLEA---LSQDLATSQASLLAKEKEL 762
              |:..:.||:.:|..:...|||::        |.:|:..||:   ::.||......|:..:.|:
Human   807 MPSERSECRLEADQSPKNSAILQNR--------VDSLEFSLESQKQMNSDLQKQCEELVQIKGEI 863

  Fly   763 KASGNKLNKIKKQHEQHQAKSSDQSARLE----ALQSELADRLSHSRQVESEKEELQARVTGILE 823
            :   ..|.|.::.|:...|::|.:.::|:    |.|:.:|:.||   .:|::::|||.    :.:
Human   864 E---ENLMKAEQMHQSFVAETSQRISKLQEDTSAHQNVVAETLS---ALENKEKELQL----LND 918

  Fly   824 EIGTMQAQMQQVQDSHSELEREKRKLESRIESLQQEQVDSSAQDERTSAKLEEIQSENTKLAERN 888
            ::.|.||::|:::.|:..||...::|:...|:|..|:.:.|:.......::||:..||..|.|.|
Human   919 KVETEQAEIQELKKSNHLLEDSLKELQLLSETLSLEKKEMSSIISLNKREIEELTQENGTLKEIN 983

  Fly   889 CLLEEQTNHLESQLQAKQDEIGKIQAKLQQVLDEHSK-----LQ------NAQELMDHDHRTLQD 942
            ..|.::..:|..:.::..:.|.:.:..:.::.|::.:     ||      ||.|.:...::..|:
Human   984 ASLNQEKMNLIQKSESFANYIDEREKSISELSDQYKQEKLILLQRCEETGNAYEDLSQKYKAAQE 1048

  Fly   943 K--------------CD-------------AYEKDKLLTKHTLDCLQSASE-------ELHRVKA 973
            |              |:             |.|..:.|||     |..|.|       ||..|:.
Human  1049 KNSKLECLLNECTSLCENRKNELEQLKEAFAKEHQEFLTK-----LAFAEERNQNLMLELETVQQ 1108

  Fly   974 NLDRELKEQD-----------QQLSELRERQREQEQQLKD---QAERCAKL-----KAQNSESE- 1018
            .|..|:.:..           |::..|:|.|.:.::::.|   :.|:..|:     :.||.||| 
Human  1109 ALRSEMTDNQNNSKSEAGGLKQEIMTLKEEQNKMQKEVNDLLQENEQLMKVMKTKHECQNLESEP 1173

  Fly  1019 -------------------------------------TQLQATISNLREQLDAYKQTEQGIQEKL 1046
                                                 .||:|.:.|...:|...::.::.:|.:|
Human  1174 IRNSVKERESERNQCNFKPQMDLEVKEISLDSYNAQLVQLEAMLRNKELKLQESEKEKECLQHEL 1238

  Fly  1047 QATNSSYTT---------QIATL-EARWSAANSDVERLHE----AND------ALQLEMEQLKIK 1091
            |.......|         :|:.| :....|....:...||    .||      :||..|.:|   
Human  1239 QTIRGDLETSNLQDMQSQEISGLKDCEIDAEEKYISGPHELSTSQNDNAHLQCSLQTTMNKL--- 1300

  Fly  1092 HGQEREEVKESI-AQKNRQVVELQEAMATRDRQLQEKIEASEKLA-KFDEILIENEYLNKHTKQL 1154
              .|.|::.|.: |:|...|.||.::.:       |.|.|:.|:| :..::|.|.:.||..:..|
Human  1301 --NELEKICEILQAEKYELVTELNDSRS-------ECITATRKMAEEVGKLLNEVKILNDDSGLL 1356

  Fly  1155 EAELAES-----------------------------------------AELKEKLKSLQCELYVL 1178
            ..||.|.                                         |||:||..|||.|..:|
Human  1357 HGELVEDIPGGEFGEQPNEQHPVSLAPLDESNSYEHLTLSDKEVQMHFAELQEKFLSLQSEHKIL 1421

  Fly  1179 QEKAEQHAVQMAEKETQSATATAE---------------VSELKKAIEEQAVELTRQK---EHAS 1225
            .::..|.:.:|:|.:|...:..||               |.|::..:||..|......   :.:|
Human  1422 HDQHCQMSSKMSELQTYVDSLKAENLVLSTNLRNFQGDLVKEMQLGLEEGLVPSLSSSCVPDSSS 1486

  Fly  1226 FVTEQSDAVQKDLLQAQQQLHD----KQIELAMSRDEQALLQAEADGLRQEVICLKEHLS-PSTD 1285
            ..:....:..:.||   :|..|    ..:|.|:|.::.::.:.....|::|.:..||..| |:..
Human  1487 LSSLGDSSFYRALL---EQTGDMSLLSNLEGAVSANQCSVDEVFCSSLQEENLTRKETPSAPAKG 1548

  Fly  1286 SDSLRSLNERLQRELEDLKHK--SAGAESNMQ-QEIEELQANNQQMAERINELETLRAGIQAQQL 1347
            .:.|.||.|..::.||.|:.|  |.|...|.: ||:|:|.::.:|      ||:.||     :|.
Human  1549 VEELESLCEVYRQSLEKLEEKMESQGIMKNKEIQELEQLLSSERQ------ELDCLR-----KQY 1602

  Fly  1348 LASMAPKNVQEAAAAGEKAELESKLKEIMNEVQDVTNRNLFLEQKCENFLILEQSNERLKLQNAK 1412
            |:              |..:.:.||..:..|::.    .|..|:|....|.||....||:||...
Human  1603 LS--------------ENEQWQQKLTSVTLEMES----KLAAEKKQTEQLSLELEVARLQLQGLD 1649

  Fly  1413 LSRQLDETLVSMQHSEAVPANTE 1435
            ||   ..:|:.:...:|:....|
Human  1650 LS---SRSLLGIDTEDAIQGRNE 1669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 203/962 (21%)
Phage_GPO <306..421 CDD:301727 31/133 (23%)
Smc 737..1442 CDD:224117 195/898 (22%)
MIT_CorA-like <1244..>1333 CDD:294313 27/97 (28%)
Grip 1433..1477 CDD:197860 1/4 (25%)
CENPFNP_057427.3 CENP-F_N 1..307 CDD:287456 45/198 (23%)
SMC_prok_B 283..1160 CDD:274008 211/983 (21%)
Smc 901..1654 CDD:224117 176/812 (22%)
CENP-F_leu_zip 2131..2270 CDD:287450
CENP-F_leu_zip 2313..2452 CDD:287450
Mplasa_alph_rch <2392..2887 CDD:275316
CENP-F_C_Rb_bdg 2967..3013 CDD:287463
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126585
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.