DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Golgin245 and golga4

Sequence 1:NP_611787.2 Gene:Golgin245 FlyBaseID:FBgn0034854 Length:1489 Species:Drosophila melanogaster
Sequence 2:XP_017950305.1 Gene:golga4 XenbaseID:XB-GENE-5799539 Length:2123 Species:Xenopus tropicalis

Alignment Length:2153 Identity:468/2154 (22%)
Similarity:843/2154 (39%) Gaps:711/2154 (33%)


  Fly     1 MFANLKNKLIEEVKASPSKFQQFANAAQAAVSSSSSTTPNSETNTSNNENFFSITEE-------- 57
            ||..||.|:.||  .||||         :.::......|.| |:|.|.....|:||:        
 Frog     1 MFKKLKQKISEE--QSPSK---------SPLAPQQQGRPRS-TSTGNRSRTSSVTEQQDDSLATA 53

  Fly    58 ---------------------DTPQNSPYRIQKLPATSASALRGRSTQSLNGATSRTRKLSNSSM 101
                                 :.||:..:::|....:..|..|....:||..::::...|.:||.
 Frog    54 DRENGSLSDNINGNDPTSSQRNEPQSFAHKLQMRVPSMESLFRSPIKESLFPSSTKENLLRSSSR 118

  Fly   102 AS--DVSFRLPTYEAPAVYHLQSDLDETSSEFDDSASTARLDVITKDQLYDAYKKSLDRYHKYRC 164
            .|  .:....|:    .|:...||::   ||.:||..:  ::.:.|:||::...:.......||.
 Frog   119 DSLNKIDMENPS----TVFDPPSDIE---SEAEDSVGS--IEGLNKEQLFNRLHRMDKSLGNYRG 174

  Fly   165 RYTDLAKKYKELERDSSKARSVLVETQDKALRRISELREQCTLEQQAKAHLEEALRVEMDDMSCK 229
            :|::|...|:.::||..|.:|:|.::||||||||.||||:..::||||.||:|.....:::....
 Frog   175 KYSELVTAYRTMQRDKEKLQSILSQSQDKALRRIGELREELQMDQQAKKHLQEEFDASLEEKDQL 239

  Fly   230 MQAYQTKLQLLGENPENITAALE----RSGQQLESE-QLIDLEESIGKSPLSTNGSSGVSDLQ-- 287
            :...||::.||....:|..::.|    .:..:|:|| .|.:::.....:|...|.::.::.||  
 Frog   240 ISVLQTQVSLLKNRLQNGQSSTELPESTASPELDSESSLQEVDTDNRSTPDDGNAANTLNALQVR 304

  Fly   288 ------------RLLKERDEQLKSVTEKYEAVRKQ------------------------------ 310
                        :.:|...||...::.:.||::.|                              
 Frog   305 VKRQENLLQRCKKSIKSHKEQCAHLSSENEALQNQLDERLQELEKIKELHTSEKSKLITQLRDAK 369

  Fly   311 ------EEENVLLLAQTKQAIHTELELKDTEVRKLQEKLKQLES-------QRES---------- 352
                  |::..:::|:||:.:|..||||:.||.:|:.::|:|.|       |:|.          
 Frog   370 NSIEQLEQDKGMMIAETKRQMHETLELKEEEVSQLRSRVKKLSSHCEELQQQKEKLEKAAFEDVE 434

  Fly   353 --HNNEVKEQFKKLQATKQEVDAKLMATEHLLNTLKESYAIKEQQVVTLE-------AQLEAIRV 408
              .:.:.::.|:|||..:|....:..:.|..:|..||...:|::.|..::       :::|.:..
 Frog   435 KISSQKAEDAFEKLQMEEQIKAIEKASEEERVNLQKELSRVKQEVVDIMKKSCDSRISEIEKVHA 499

  Fly   409 E---------NEQ---KVKDLQ------KQNED----------------------RNTQASDSSE 433
            |         |||   |.::.|      |:|||                      :.|..|.::|
 Frog   500 EALLNKEQEYNEQIRLKEQEFQDQMNAVKKNEDETLNLLQDKEKSLMALEELERQKKTIESRAAE 564

  Fly   434 QLKKLQAAVQDAESQLL---------SKDQ----LLESLRSEQAAKEQQLKHL------------ 473
            |||::|..|::...::|         ||.|    |:|:.|:...|:...:|.:            
 Frog   565 QLKEMQQEVENCRMRILDLESSVAEESKSQDFVSLIETERNNHNAEVATIKEMHKQDLDVLVQDQ 629

  Fly   474 ----KEQLGKLKQENENYLDKLREN-KKSSDSQTNEAQD-------------------QQKKLQA 514
                .|:|..||:||...:.:|:|. ::..||...|.:.                   :|.:|:.
 Frog   630 ERIWSEKLELLKKENHTKIIELKEKYQRDYDSHLKEKEHNFQEHIEHMNEKTLEKLDVKQTELET 694

  Fly   515 ----------AKDEAESKLLATEELLHSLRNDYKAQ--------EEKVALL--EDKLKTLSKEND 559
                      |:.|.|.||..||..:..::.:|:||        .|::..:  |.::.|...|.|
 Frog   695 LSAELSEAIKARQEIEQKLTDTENEISKIKLEYEAQIKEEREKHSEEIGSIEREKEMHTQGVEKD 759

  Fly   560 V--NVEKLHHINEQREAQSTDSQQKINELRAAKDEAEA------KLLST---EHSLN------AL 607
            :  |:..|..:.:.:|.:..:.:::..:|:.|.::|||      .||..   .|.:|      |.
 Frog   760 LKENINNLKLLQDSKECELEEFRKENQKLKEAAEKAEADHKEAFALLEAARHSHEINTHEKEQAY 824

  Fly   608 QAALSAKEEQAASLEQSLNALK--TE-SEHSLQDLRLHNDQLLEIVQR-----HQQN-------- 656
            :..|...:|....:.|..|.||  || :|..|:::::..|.....||.     |:::        
 Frog   825 ELKLKELQEMLKGMTQERNDLKEVTEKAETQLKNMQIELDSNKAQVQSLTKQIHEESMNMADKLN 889

  Fly   657 ----DWEAQ---LARAREELAAIQSQRELHALELEKSLEMERESVAALN---SEK----ASQEEQ 707
                :.|.|   |....||::.|.|:|| |  ||:|..|...:.:..||   |||    .|.:|.
 Frog   890 TLVLESETQVKGLKEQIEEISRIASERE-H--ELKKVKEDHIQIILDLNNTISEKEKNILSLQED 951

  Fly   708 HRL-------KLEQLQREIQILQDQHANSESETVAALKGQLEALSQDLATSQASLLAKEKEL-KA 764
            :::       |:|:|:::.:.||:......||..:.||.::|....:|...:.....|..|: :|
 Frog   952 YKVKHKNLDAKMEKLKQKFKELQESSKKKYSELESKLKKEIEKKQNELINKEREFNEKIHEMAQA 1016

  Fly   765 SGNKLN------------KIKKQHEQHQAKSSDQSARLEALQSELADRLSHSRQVESEKEELQAR 817
            |...:|            :|:...:.||.:..:.:...|...|:||:.|.     |..:||||.:
 Frog  1017 SSTGINHAMAQLELNHKEQIQNMTDNHQRELQETTEACEKKLSQLAEDLR-----EKHEEELQEK 1076

  Fly   818 VTGILEEIGTMQAQMQQVQDSHSELE--RE-KRKLESRIESLQQEQVDSSAQDERTSAKLEEIQS 879
            ...|.|.......:.::.:|:..|:.  || |.::::....||::...|:||....:....|.::
 Frog  1077 DQVIAESRKQFNIKNKEKEDADKEISDLRELKTQMDATFNDLQEQLCQSAAQVLHLTQSENEFKT 1141

  Fly   880 ENTKLAERNCLLEEQTNHLE---SQLQAKQDEI-GKI---QAKLQQVLDEHSKL----------- 926
            ..|:|.....:|::|.:.|:   .:.::|.||| .|:   :.|.|.:...|:|:           
 Frog  1142 NCTRLTTEKQILQQQLDELKILAEEDKSKNDEIVNKVRLAEEKYQDLETLHNKVRADFAKELQDK 1206

  Fly   927 -----------------------QNAQELMD---------HDHR--------------------- 938
                                   :||::|.:         |.::                     
 Frog  1207 LVEKENEFKHLLVKQENQLILCCKNAEDLFETLANGLTENHKYKLNGLIVKIANLESCMHKLKEV 1271

  Fly   939 TLQDKCDAYEKDKLLTKHTLD------CLQSASEELHRVKANLDRELKEQDQQLSELRERQREQE 997
            ||:.:...||::|.|.:.:.:      .|..|::|......:|..|::..:.| :|:.:::...:
 Frog  1272 TLKQRSRIYEQEKQLEQFSNELLSVNQSLNQATQEKEFATLSLKNEIEALNFQ-NEMLKKEGGSQ 1335

  Fly   998 QQLKDQAERC-AKLKAQNS----------------ESE-TQLQATISNL------------REQL 1032
            ||:.|:.|.| .:||.:.|                ||| :.|.|.|:.|            :|..
 Frog  1336 QQVADEKESCITQLKKELSENINIVTSLTEVVKQKESEVSSLSALINELKLKHENCVDLTEKENA 1400

  Fly  1033 DAY-----KQTEQGIQEKLQATNSSYTTQIATLEARWSAANSDVERLHEANDALQLEMEQLKIKH 1092
            .|:     ||::|.:|.::|    ....:|..|....||...:..:|....|..:.:.|...:::
 Frog  1401 IAFLTAQQKQSQQELQNQIQ----DLMAKIEVLNKEKSAQIDEAAKLKNKLDEWKKKAELKFVQN 1461

  Fly  1093 GQEREEVKESIAQKNRQVVELQEAMAT---------------------RDRQLQEKIEA------ 1130
            ....:|:||.:...|:|:||..|.:.|                     ::.:|..::|.      
 Frog  1462 HNTIKELKEKVESVNKQIVEKDEKLRTVTEEFECHRSNIQETQLMSESKEFELTTQLEGQKSKIS 1526

  Fly  1131 ----------SEKLAKFDEILIENEYLNKHTKQLEAELA--------ESAELKEKLKSLQCELYV 1177
                      |||.:..|:|.|:....::..|.|..:|.        .|.|::.|:.:|:.|:..
 Frog  1527 ELEDQCSKLMSEKKSLMDQIEIQTIQQSEDKKALVEQLQHIQYASDNNSKEVQNKVITLEKEIDA 1591

  Fly  1178 LQEK--AEQ--------HAVQMAEKETQ------SATATAEVSELKKAIEEQAVELTRQ------ 1220
            |:||  |||        ...|:.:||.:      :|.:|.::|||||..|::...|.:|      
 Frog  1592 LKEKLDAEQTKWQLEKAECFQLKDKELKILEEKLTAESTNKLSELKKKAEQKIASLKKQLMSQID 1656

  Fly  1221 -KEHASFVTE------------QSDAVQ------------------------------------- 1235
             ||.:....|            :|..||                                     
 Frog  1657 EKEQSRKALESQLNVLKDNMQKESQEVQEGLQQKVENQDKKYALLLEQKKNTEADLANIRSELKL 1721

  Fly  1236 --------KDLLQAQQQLHDKQIELAMSRDEQALLQ----------------------------- 1263
                    :|:|:..||.|.:: ||..|..|||||:                             
 Frog  1722 KELRVKEMEDILKDVQQKHSER-ELTDSEKEQALLKELESQMLTNNQLVSTHEKALRALQDDLNV 1785

  Fly  1264 --AEADGLRQEV-----------ICLKEHLSPST---------DSDSLRSLNE--RLQRELEDL- 1303
              ||....::|:           :..:|..|..:         :|:.|:..||  :||:::..| 
 Frog  1786 KDAEIKTFKEEIDEKSKSLNELQVLFEETQSQESAMRIKLEEMESEKLKFKNEITKLQKDMRSLR 1850

  Fly  1304 -----------KHKSAGAESNM--QQEIEELQAN----------NQQMAERINELET-------- 1337
                       |..:..||..:  :||..||:.|          |.|||::..|:||        
 Frog  1851 KEHSQELDLLKKEITEEAEQRIKYEQEDSELKHNSKLKQLMREFNTQMAQKEREVETAVQETIAK 1915

  Fly  1338 --------LRA-GIQAQQLLASMAPK---------------NVQEAAAAGEKAELESKL------ 1372
                    :|: .|:|..|...:|.|               ..:|.....:..||:.:|      
 Frog  1916 AQEVEAELMRSQQIEAVHLHKKIAEKEDDLKRTVKRYEELLEAREEEMTAKVTELQEQLERLQEQ 1980

  Fly  1373 ---KEIMNE----VQDVTNRNLFLEQKCENFLILEQSNE-RLKLQNAK-----LSRQLDETL--- 1421
               ||:.||    |::.|:..:|..|..:.   ..|.|| :||.|..|     |..|:....   
 Frog  1981 LTQKEMQNEEEENVEEATSPEVFQAQLAQK---TSQVNEYKLKEQELKEKVHILEDQVKNFTRGV 2042

  Fly  1422 -----------VSMQHS--EAVPANTEFEYLRNIMFQYLTGNTNNETLVKVISAVLKFSPQQAQV 1473
                       |:.||:  ......|||||||.:||:|:.|. ..:|:.|||:.||:|...|||.
 Frog  2043 FYTPIGTPYKEVNNQHAGVSVFGEPTEFEYLRKVMFEYMMGR-ETKTMAKVITTVLRFPTDQAQQ 2106

  Fly  1474 ALEKEHQR 1481
            .|::|..|
 Frog  2107 ILQREETR 2114

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Golgin245NP_611787.2 Smc 286..1089 CDD:224117 242/1170 (21%)
Phage_GPO <306..421 CDD:301727 38/195 (19%)
Smc 737..1442 CDD:224117 222/1102 (20%)
MIT_CorA-like <1244..>1333 CDD:294313 34/166 (20%)
Grip 1433..1477 CDD:197860 22/44 (50%)
golga4XP_017950305.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C353878166
eggNOG 1 0.900 E1_28M43
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005529
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.