DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yip3 and PUP1

DIOPT Version :9

Sequence 1:NP_523819.2 Gene:yip3 / 37683 FlyBaseID:FBgn0040063 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_014800.3 Gene:PUP1 / 854328 SGDID:S000005683 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:43/183 - (23%)
Similarity:79/183 - (43%) Gaps:25/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IVGLKSTNAVILATDSKEYE-----------MYLIDDRIYCCAPRSGIDRNIVLEV---SSKVAN 64
            |||:|..|.|::|.|::..:           ::.|..:|:|....:..|...|.::   :.::.:
Yeast    32 IVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHS 96

  Fly    65 LVRDRGQN-VTVSQVRDMFCEKYQTAESPNVMIAGQDSRGLHLFSMEC-GKSRMVMYGAKGRDKE 127
            |...|... |:..|:......|||......:::||.|..|.||||:.. |.:.:..|.:.|....
Yeast    97 LYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSL 161

  Fly   128 NIVDFLSKDWNDFINLSEAEQLARKALR---W------EHVEMCTIYRAKEIE 171
            ..:..|...|...:...||.:||..|::   |      .:|::|.:...|:.|
Yeast   162 AAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAE 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yip3NP_523819.2 Ntn_hydrolase 14..155 CDD:294319 38/156 (24%)
PUP1NP_014800.3 proteasome_beta_type_7 30..219 CDD:239732 43/183 (23%)
Pr_beta_C 223..257 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.