DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and KINESIN-13A

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_188285.1 Gene:KINESIN-13A AraportID:AT3G16630 Length:794 Species:Arabidopsis thaliana

Alignment Length:701 Identity:246/702 (35%)
Similarity:334/702 (48%) Gaps:150/702 (21%)


  Fly    14 RSDGRVHLAEIIKLEGGDSKLITVEWPEGHTVRGKELPLELVVLMNPHIFDSPRCSGGNAASANQ 78
            :|.|..|||..:...|.|.:.:.....:|:..:..|....|..||....|:....|.....:|:.
plant    36 QSAGLQHLASPVASTGNDQRHLPNLLMQGYGAQTAEEKQRLFQLMRNLNFNGESTSESYTPTAHT 100

  Fly    79 TASI-------SPR----------SMKQRIATGSLSPVLATAPPRQQTAPPVREDEVVHQAERMR 126
            :|::       ||.          .:.....|..||..:.|.|.......|           .:.
plant   101 SAAMPSSEGFFSPEFRGDFGAGLLDLHAMDDTELLSEHVITEPFEPSPFMP-----------SVN 154

  Fly   127 KERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRV----RSGTTNERINCHQ 187
            ||.|......|.                        |.||:|.|::.:    :|...|..:  .:
plant   155 KEFEEDYNLAAN------------------------RQQRQQTEAEPLGLLPKSDKENNSV--AK 193

  Fly   188 IMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNAT 252
            |.|.||||||.:||.|.:|:|||:: |.::|.|||||..|:|..::|.|.|.||.|.||:.||..
plant   194 IKVVVRKRPLNKKETAKKEEDVVTV-SDNSLTVHEPRVKVDLTAYVEKHEFCFDAVLDEDVSNDE 257

  Fly   253 VYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKTV 317
            ||..|..|:|..||....||||||||||||||:|| ...|.|           |.:|:...|:..
plant   258 VYRATIEPIIPIIFQRTKATCFAYGQTGSGKTFTM-KPLPIR-----------AVEDLMRLLRQP 310

  Fly   318 PYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLELG 382
            .|:....|::.|:|||||.::||||...| :|.:.||..|||.:|||.:..|.:...|.|.:|.|
plant   311 VYSNQRFKLWLSYFEIYGGKLFDLLSERK-KLCMREDGRQQVCIVGLQEYEVSDVQIVKDFIEKG 374

  Fly   383 NSVRTSGHTSANSKSSRSHAVFQIVLR------------SAAGE---KLHGKFSLIDLAGNERGA 432
            |:.|::|.|.||.:||||||:.|:|::            :.:.|   |:.||.|.|||||:||||
plant   375 NAERSTGSTGANEESSRSHAILQLVVKKHVEVKDTRRRNNDSNELPGKVVGKISFIDLAGSERGA 439

  Fly   433 DNSSADRQTRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAM 497
            |.:..|||||:||:|||||||.||||||||.....|:||||||||:||||||:|..  :|.||:.
plant   440 DTTDNDRQTRIEGAEINKSLLALKECIRALDNDQLHIPFRGSKLTEVLRDSFVGNS--RTVMISC 502

  Fly   498 ISPCLHSVEHTLNTLRYADRVKELSVESIPSKR------MPDAN----LGSTSMSDIV------- 545
            |||...|.||||||||||||||.|| :|..||:      ||..|    ||...:.|:.       
plant   503 ISPNAGSCEHTLNTLRYADRVKSLS-KSGNSKKDQTANSMPPVNKDPLLGPNDVEDVFEPPQEVN 566

  Fly   546 ------------CQSSTQRL-------------FPCASSTSMPGGGNQAQQ----HTNTANDLNR 581
                        ..|||..:             .|   |.||..|.::...    .|:..|:::.
plant   567 VPETRRRVVEKDSNSSTSGIDFRQPTNYREESGIP---SFSMDKGRSEPNSSFAGSTSQRNNISS 628

  Fly   582 SQKPTS------KPTYPTSGQQLVQRKGS-----SQREASMMLTKSLAQFR 621
            ..:.||      |...|..|:.|.:.|..     |:|:.|.....:|..||
plant   629 YPQETSDREEKVKKVSPPRGKGLREEKPDRPQNWSKRDVSSSDIPTLTNFR 679

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 176/347 (51%)
Kinesin 193..520 CDD:278646 174/342 (51%)
KINESIN-13ANP_188285.1 SAM_superfamily 29..84 CDD:301707 12/48 (25%)
KISc_KIF2_like 193..524 CDD:276818 176/347 (51%)
Kinesin 199..525 CDD:278646 174/342 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 329 1.000 Inparanoid score I666
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D418348at2759
OrthoInspector 1 1.000 T32386
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.615 Consistency score
43.970

Return to query results.
Submit another query.