DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Kif2b

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_082823.1 Gene:Kif2b MGIID:1920720 Length:668 Species:Mus musculus

Alignment Length:573 Identity:277/574 (48%)
Similarity:373/574 (65%) Gaps:50/574 (9%)


  Fly    10 IFIRRSDGRVHLAEIIKLEGGDSKLITVEWPEGHTVRGKELPLELVVLMNPHIFD---------- 64
            :.|:|||.|:|||.:.:: ..::..:||||.|....:||::.||.|:|:||.:..          
Mouse    32 VAIQRSDKRIHLAVVTEI-NRENSWVTVEWVEKGVKKGKKIELETVLLLNPALASLEHQRSRRPL 95

  Fly    65 -----SPRCSGGNAASANQTASISPRSMKQRIATGSLSPVLATAPP---RQQTAPPVREDEVVHQ 121
                 .|..:.|:..:|.:..::.|.  :....:|....::..:.|   :::.:|.:||      
Mouse    96 RPVSVVPSTAIGDQRTATKWIAMIPH--RNETPSGDSQTLMIPSNPCLMKRKKSPCLRE------ 152

  Fly   122 AERMRKERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNERINCH 186
            .|:::|:||:||..|...|..|....|  .||||:|..|||...|.:::|.::.|....|.   |
Mouse   153 IEKLQKQREKRRRLQLEIRARRALDIN--TGNPNFETMRMIEEYRRRLDSSKMSSLEPPED---H 212

  Fly   187 QIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNA 251
            :|.||||||||.::|...::.|:::|||.:.::|||.::.|:|.::|||.:|.||:.||::.||.
Mouse   213 RICVCVRKRPLNQRETTMKDLDIITIPSHNVVMVHESKQKVDLTRYLENQTFCFDHAFDDKASNE 277

  Fly   252 TVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKT 316
            .||:||||||::.||..||||||||||||||||:||||.|.|:.|....||||:.|:|||..|||
Mouse   278 LVYQFTARPLVESIFRKGMATCFAYGQTGSGKTHTMGGAFLGKAQDCSKGIYALVAQDVFLLLKT 342

  Fly   317 VPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLEL 381
            ..|.||.||||.:||||||.:|:||| ..|.:|:||||.|||||||||.:..|....|||:|:||
Mouse   343 PAYEKLELKVYGTFFEIYGGKVYDLL-NWKKKLQVLEDGNQQVQVVGLQEQEVSCVEEVLNLVEL 406

  Fly   382 GNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRLEGS 446
            |||.||||.||.|:.|||||||||::|:  ||.||||||||:||||||||||.:.|.|:.:|||:
Mouse   407 GNSCRTSGQTSVNAHSSRSHAVFQLILK--AGGKLHGKFSLVDLAGNERGADTAKATRKRQLEGA 469

  Fly   447 EINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNT 511
            |||||||.|||||||||:..||.|||.|||||||||||| |:...|||||.|||.:.|.|:||||
Mouse   470 EINKSLLALKECIRALGKNKSHTPFRASKLTQVLRDSFI-GQNSYTCMIATISPGMTSCENTLNT 533

  Fly   512 LRYADRVKELSVE--------SIPSKRMP------DANLGSTSMSDIVCQSST 550
            ||||:|||||::|        |.|...:|      :.|.|.:...|.|.|..|
Mouse   534 LRYANRVKELALEARPYHHCVSPPGHEVPLMIENDNTNSGKSLQRDEVIQIPT 586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 211/332 (64%)
Kinesin 193..520 CDD:278646 208/327 (64%)
Kif2bNP_082823.1 KISc_KIF2_like 213..541 CDD:276818 211/332 (64%)
Kinesin 219..542 CDD:278646 208/327 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.