DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and cmet

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_524993.3 Gene:cmet FlyBaseID:FBgn0040232 Length:2189 Species:Drosophila melanogaster

Alignment Length:366 Identity:123/367 (34%)
Similarity:192/367 (52%) Gaps:47/367 (13%)


  Fly   184 NCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHS--FRFDYVFDE 246
            |...|.||::.||..              |...:|...:.|:.::|.   ::|:  :.|||||||
  Fly     5 NASSIQVCIKVRPCE--------------PGLTSLWQVKERRSIHLA---DSHAEPYVFDYVFDE 52

  Fly   247 ECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGG--QFPGRHQSSMDGIYAMAAKD 309
            ..||..|::..|:.::.....|...|.||||||.|||||||.|  |.|        |:..:|||:
  Fly    53 GASNQEVFDRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNP--------GVMVLAAKE 109

  Fly   310 VFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAE 374
            :|..:.:.......|:|  .:.|||..:::|||......|::.|..|..|. |...:..:.:..:
  Fly   110 IFQQISSETERDFLLRV--GYIEIYNEKIYDLLNKKNQDLKIHESGNGIVN-VNCEECIITSEVD 171

  Fly   375 VLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEK------LHGKFSLIDLAGNERGAD 433
            :|.||.|||..||.|.|:.|.:||||||:|:|::.|...:.      :....:|:||||:|| ||
  Fly   172 LLRLLCLGNKERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSER-AD 235

  Fly   434 NSSADRQTRL-EGSEINKSLLVLKECIRALGRQSSH--LPFRGSKLTQVLRDSFIGGKKVKTCMI 495
            .:.| |..|| ||..||||||.|...|::|...:.:  ..:|.||||::|:.| :||... |.:|
  Fly   236 QTGA-RGARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQAS-LGGNAF-TSII 297

  Fly   496 AMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMPDANL 536
            ..|.|.:  :|.:.:||.:|.|.|::.::...::.:.||.:
  Fly   298 CTIKPSI--MEESQSTLSFATRAKKIRIKPQVNEMVSDATM 336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 119/345 (34%)
Kinesin 193..520 CDD:278646 117/340 (34%)
cmetNP_524993.3 KISc 8..328 CDD:214526 120/354 (34%)
Motor_domain 8..321 CDD:277568 120/347 (35%)
Smc <680..1449 CDD:224117
TMPIT 779..>867 CDD:285135
Smc 1042..1910 CDD:224117
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122344039
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.