DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and sub

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001286548.1 Gene:sub FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster

Alignment Length:494 Identity:124/495 (25%)
Similarity:192/495 (39%) Gaps:127/495 (26%)


  Fly   129 RERRREAQARTRLDREQGKNEDPG-------NPNWEVARMIRLQREQMES----------QRVRS 176
            ||.|....||           ||.       .||.::.....:|..:.||          .:.:|
  Fly    12 REVRSFLMAR-----------DPSIDRRFRPRPNKKMRLFDNIQESEEESFSEYSDTESEYKYQS 65

  Fly   177 GTTNERINCHQI-----------MVCVRKRPLR---RKELADREQDVVSIPSKHTLVVHEPRKHV 227
            ....|..:|...           .|.:|.||::   :..:...|.:|:....|    |.....:|
  Fly    66 SEATEGASCATSAADSSNVETGPQVFLRLRPVKDASKAYIVSEEANVLITSCK----VDSTSNNV 126

  Fly   228 NLVKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQ-- 290
            |.   :|.| |.|..:||.......:|:....|   .|.:....|...||.:|||||||:.|.  
  Fly   127 NR---MEKH-FGFTSIFDSTVGQRDIYDTCVGP---KIMEEECVTIMTYGTSGSGKTYTLLGDDV 184

  Fly   291 FPGRHQSSMDGIYAMAAKDVF------------------STLKTVPYNK---------------- 321
            ..|....:::.|:.:....||                  ::||.:...|                
  Fly   185 RAGIIPRALENIFTIYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRL 249

  Fly   322 -----------------LNLKVYCSFFEIYGTRVFDLL-MPGK---------PQLRVLEDRNQQV 359
                             :::.|:.||.|||...|:||| :|.|         ..|:::.::. .|
  Fly   250 KQVIDGDHMFETKASTDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNKG-HV 313

  Fly   360 QVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQI-VLR-SAAGEKLHGKFSL 422
            .:.|||...|.::.|.|.||.||....|...||.|:.|||||.||.: :|: :.:|......:..
  Fly   314 FIKGLTSVFVTSSEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYKF 378

  Fly   423 IDLAGNERGADNSSADRQTRLEGSEINKSLLVLKECIRALG-----RQSSHLPFRGSKLTQVLRD 482
            .||||:|| .:|:........|...||.||:||..|:.|..     :.:..:|:|.||||.:|:.
  Fly   379 CDLAGSER-VNNTGTSGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQA 442

  Fly   483 SFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKEL 521
            :.:|  |.|..||..::|.....|..||.|.:|...|.:
  Fly   443 ALLG--KEKLAMIVTVTPLDKYYEENLNVLNFASIAKNI 479

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 108/416 (26%)
Kinesin 193..520 CDD:278646 108/400 (27%)
subNP_001286548.1 KISc 89..477 CDD:276812 108/403 (27%)
Kinesin 93..479 CDD:278646 108/401 (27%)
GBP_C <512..603 CDD:303769
coiled coil 576..586 CDD:293879
coiled coil 592..603 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122348992
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.