DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and kif2c

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001006856.1 Gene:kif2c XenbaseID:XB-GENE-961445 Length:734 Species:Xenopus tropicalis

Alignment Length:682 Identity:296/683 (43%)
Similarity:385/683 (56%) Gaps:122/683 (18%)


  Fly    12 IRRSDGRVHLAEIIKLEGGDSKLITVEWPEGHTVRGKELPLELVVLMNPHIFDS----PRCSGG- 71
            |.||:|.:|.|.|..: ..|...:.|||.||...:|||:....|:.:||.:.|:    |..... 
 Frog    17 IMRSNGVIHNASITSV-NMDRSSVNVEWKEGDANKGKEISFADVISVNPELLDAVLAPPNVKENM 80

  Fly    72 ----NAASANQ---TASISPRSMKQRIATGSLSP-----------------------------VL 100
                |..|.||   |.|..| :.|:.....||.|                             |.
 Frog    81 PPQRNVPSQNQKRKTISKIP-APKEVTTQNSLLPEYGAQSVLRERSTRMTAIHEALPSENEMEVE 144

  Fly   101 ATAPPRQQTA-------------------------------PPVREDE------VVHQAERMRKE 128
            :|..|.||.:                               ||||.::      :|.:.|:|:.:
 Frog   145 STVLPVQQNSIQVGRSRSTKASVAGELRSQPRISEIVEESLPPVRNNQARRKSNIVKEMEKMKNK 209

  Fly   129 RERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNERINCHQIMVCVR 193
            ||.:|...:..|:.|.|  :.|...||||..:||:..|..|:..|:......|.   |:|.||||
 Frog   210 REEQRAQNSELRIKRAQ--DYDTSIPNWEFGKMIKDFRATMDCHRISMADPAEE---HRICVCVR 269

  Fly   194 KRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNATVYEFTA 258
            ||||.::||:.:|.|::|:|||:.::||||:..|:|.|:|||..|||||.|||..:|..||.|||
 Frog   270 KRPLNKQELSKKEIDIISVPSKNIVLVHEPKLKVDLTKYLENQPFRFDYSFDETATNEVVYRFTA 334

  Fly   259 RPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKTVPYNKLN 323
            |||::.||:||.||||||||||||||:||||.|.|:.|:...|:||.|::|||..|....|..|:
 Frog   335 RPLVQSIFEGGKATCFAYGQTGSGKTHTMGGDFSGKSQNVSKGVYAFASRDVFLLLDQPRYKHLD 399

  Fly   324 LKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLELGNSVRTS 388
            |.|:.:|||||..:|||||.. |.:||||||..|:||||||.:..|.:..:|..::|:|::.|||
 Frog   400 LDVFVTFFEIYNGKVFDLLNK-KAKLRVLEDAKQEVQVVGLLERQVTSADDVFKMIEVGSACRTS 463

  Fly   389 GHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRLEGSEINKSLL 453
            |.|.|||.||||||..||:||  .|.||||||||:||||||||||.:||||.||:||:|||:|||
 Frog   464 GQTFANSSSSRSHACLQIILR--RGSKLHGKFSLVDLAGNERGADTASADRITRMEGAEINRSLL 526

  Fly   454 VLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRV 518
            .|||||||||:..||.|||.|||||:|||||| |:..:||||||:||..:|.|:|||||||||||
 Frog   527 ALKECIRALGQNKSHTPFRESKLTQILRDSFI-GENSRTCMIAMLSPGFNSCEYTLNTLRYADRV 590

  Fly   519 KELSVESIPSKRMPDANLG-STSMSDIVCQSSTQRLFPCASSTSMPGGGNQAQQ----------- 571
            ||||.::..:.   |.||. .|..||             .|..|:  ||.|.|.           
 Frog   591 KELSPQNAETN---DDNLQMETEDSD-------------GSHASI--GGLQLQDDFLLKDEELST 637

  Fly   572 HTNTAND-LNRSQKPTSKPTYPTSGQQLVQRK 602
            |.|:..| |||..:...|.....  ::||||:
 Frog   638 HINSFQDALNRVGELEEKAVEEL--RELVQRE 667

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 207/332 (62%)
Kinesin 193..520 CDD:278646 204/327 (62%)
kif2cNP_001006856.1 KISc_KIF2_like 263..591 CDD:276818 207/332 (62%)
Kinesin 269..592 CDD:278646 204/327 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C360284953
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.710

Return to query results.
Submit another query.