DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and zgc:103670

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_005166887.1 Gene:zgc:103670 ZFINID:ZDB-GENE-040912-111 Length:747 Species:Danio rerio

Alignment Length:573 Identity:290/574 (51%)
Similarity:361/574 (63%) Gaps:71/574 (12%)


  Fly    12 IRRSDGRVHLAEIIKLEGGDSKLITVEWPEGHTVRGKELPLELVVLMNPHIFDSPRCSGGNAASA 76
            |:|||||:|.|.:..| ..|::.:||||.|....:|||:.||.:..:||.:......|.......
Zfish    16 IKRSDGRIHQAMVTSL-NEDNESVTVEWIENGDTKGKEIDLECIFSLNPDVAPEEEISLSPVTPP 79

  Fly    77 NQTASISPRSMK--------QRIATG------------------------------SLSPVLATA 103
            ..|    |.|:|        :.||.|                              ...|..|..
Zfish    80 PPT----PSSVKVNKIPKNRRTIAPGRSEIPSRDNRVGSTRARPAQQLQQQQQQQPQPQPESAPP 140

  Fly   104 PPRQQTAPPV-----------------REDEVVHQAERMRKERERRREAQARTRLDREQGKNEDP 151
            ||.||.:.|.                 |:...|.:.|:::::|||||..|...|..|.|  ..|.
Zfish   141 PPAQQPSQPTQSQTQSQLTQQQQQNARRKSNCVKEVEKLQEKRERRRLQQQELREKRAQ--EVDT 203

  Fly   152 GNPNWEVARMIRLQREQMESQRVRSGTTNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKH 216
            ..||:|:.:|||..|..::   .|..||.:.|..|:|.||||||||.:|||:.::.||::||||.
Zfish   204 TIPNYEILQMIRDFRGSLD---YRPLTTTDLIEEHRICVCVRKRPLNKKELSVKDLDVITIPSKD 265

  Fly   217 TLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGS 281
            .::||||::.|:|.::|||.:|||||.||:..:|..||.||||||::.|||.|||||||||||||
Zfish   266 VVMVHEPKQKVDLTRYLENQTFRFDYAFDDSTTNEMVYRFTARPLVETIFDRGMATCFAYGQTGS 330

  Fly   282 GKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGK 346
            |||:||||.|.|::|....||||:||:|||..||...|.||:|:||.:|||||..:||||| ..|
Zfish   331 GKTHTMGGDFSGKNQDCSKGIYALAARDVFLMLKKPNYKKLDLQVYATFFEIYSGKVFDLL-NRK 394

  Fly   347 PQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSA 411
            .:||||||..||||||||.:..|:.|.:||.|:|:|||.||||.||||:.||||||||||:||..
Zfish   395 AKLRVLEDGKQQVQVVGLQEREVKCTEDVLKLIEIGNSCRTSGQTSANAHSSRSHAVFQIILRRK 459

  Fly   412 AGEKLHGKFSLIDLAGNERGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKL 476
            .  |:|||||||||||||||||.|||||||||||:|||||||.||||||||||...|.|||.|||
Zfish   460 G--KMHGKFSLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKECIRALGRNKPHTPFRASKL 522

  Fly   477 TQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKE--LSVESIP 527
            ||||||||| |:..:|||||.|||.:.|.|:||||||||:||||  :|...||
Zfish   523 TQVLRDSFI-GENSRTCMIATISPGMASCENTLNTLRYANRVKEFGISPSDIP 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 223/332 (67%)
Kinesin 193..520 CDD:278646 220/327 (67%)
zgc:103670XP_005166887.1 KISc 236..572 CDD:214526 226/340 (66%)
KISc_KIF2_like 236..564 CDD:276818 223/332 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3177
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.