DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Kif3C

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_651939.4 Gene:Kif3C FlyBaseID:FBgn0039925 Length:649 Species:Drosophila melanogaster

Alignment Length:469 Identity:145/470 (31%)
Similarity:208/470 (44%) Gaps:79/470 (17%)


  Fly   188 IMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNAT 252
            |.|.||.||:.:.|.....|::|.| ::..:.|..|...::     :...|.||.|::.:.....
  Fly     5 IKVVVRCRPMNQTEKERNCQNIVEI-NEFAVSVTNPSARIS-----QQKKFIFDSVYNMKTDTEV 63

  Fly   253 VYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLK-T 316
            :|:.....|::...:|...|.|||||||.|||:||.|.   .:.|:..||.......:|..:. |
  Fly    64 IYDEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGD---ENFSNSTGIIPKCFDHIFERISMT 125

  Fly   317 VPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVG---------------LTQ 366
            .....|.|..|   .|||..|:.|||           ::|:...|:.               ||.
  Fly   126 TNVRYLALVTY---LEIYNERIRDLL-----------NKNENTNVINHFLKELPGIGVSVPTLTT 176

  Fly   367 NPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLR----------SAAGEKLHGKFS 421
            .||.|..:..|.|..||..|.:..|..|..|||||.:|.|.|.          .|.|....||.|
  Fly   177 QPVVNANQCYDWLHFGNKNRVTAATLMNKNSSRSHTIFTITLEQSPFLNSIGSDAFGGICRGKLS 241

  Fly   422 LIDLAGNERGADNSSADRQTRL-EGSEINKSLLVLKECIRAL-GRQSSHLPFRGSKLTQVLRDSF 484
            |:||||:||  ...:..:..|| |.|:||.||..|...|.:| ..::.|:|||.||||::|:|| 
  Fly   242 LVDLAGSER--QRKTGAQGDRLKEASQINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDS- 303

  Fly   485 IGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQSS 549
            :|| ..||.||:.|||.....:.|::|||||.|.|.:|.:...::...||.|.......:..:..
  Fly   304 LGG-NTKTLMISCISPTDIHYDETISTLRYASRAKNISNKPKINEDPKDARLRQYQNEILYLKRM 367

  Fly   550 TQRLFPCASSTSMPG----GGNQAQQHTN---TAN----DLNRSQKPT--------SKPTYPTSG 595
            .|......:..:.|.    ...:..||||   |.|    ||.|:.|.:        :||.:|   
  Fly   368 LQESQQIINKNNDPNKIIKSPLKIIQHTNMNSTKNVQIIDLGRNCKASFKTNNSILTKPNFP--- 429

  Fly   596 QQLVQRKGSSQREA 609
              |:|.|...|.:|
  Fly   430 --LIQSKEEVQLQA 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 120/359 (33%)
Kinesin 193..520 CDD:278646 118/355 (33%)
Kif3CNP_651939.4 Motor_domain 3..339 CDD:277568 121/361 (34%)
Kinesin 10..339 CDD:278646 118/356 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122348847
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.