DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and ncd

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001287592.1 Gene:ncd FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster

Alignment Length:620 Identity:147/621 (24%)
Similarity:251/621 (40%) Gaps:138/621 (22%)


  Fly    22 AEIIKLEG----GDSKLITVEWPEGHTVRGKELPLELVVLMNPHIFDSPRCSGGNAASANQTASI 82
            :::.:|.|    ...:|:....|...|....:.|        |....:||.:||.||        
  Fly   120 SKVSRLGGALTVSSQRLVRPAAPSSITATAVKRP--------PVTRPAPRAAGGAAA-------- 168

  Fly    83 SPRSMKQRIATGSLSPVLATAPPRQQTAP---PVREDEVVHQAERMRKERERRRE---------- 134
                 |:...||:.:...|.|...::.||   ..|..:::.:.:.::.:.|::.|          
  Fly   169 -----KKPAGTGAAASSGAAAAAPKRIAPYDFKARFHDLLEKHKVLKTKYEKQTEDMGELESMPQ 228

  Fly   135 --AQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNERINCHQI--------- 188
              .:.:.:|...:...::..:.|..:.|.::....::|:.....|.|.|.::..|.         
  Fly   229 QLEETQNKLIETESSLKNTQSDNECLQRQVKQHTAKIETITSTLGRTKEELSELQAIHEKVKTEH 293

  Fly   189 ------MVCVRKRP-------------------------LRRKELADREQDV---------VSIP 213
                  :|.:|:|.                         :.||||.:...|:         :..|
  Fly   294 AALSTEVVHLRQRTEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRGNIRVFCRIRPP 358

  Fly   214 SKH-------TLVVHEPRKHVNLVKF-------LENHSFRFDYVFDEECSNATVYEFTARPLIKH 264
            .:.       |...|: ...|.|...       :....|.||.||....|.:.::|..: |||:.
  Fly   359 LESEENRMCCTWTYHD-ESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEMVS-PLIQS 421

  Fly   265 IFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKTVPYNKL--NLKVY 327
            ..||.....||||||||||||||.|      .....|:.......:|.:::  .|..|  ..::.
  Fly   422 ALDGYNICIFAYGQTGSGKTYTMDG------VPESVGVIPRTVDLLFDSIR--GYRNLGWEYEIK 478

  Fly   328 CSFFEIYGTRVFDLLMPGKP--QLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLELGNSVRTSGH 390
            .:|.|||...::|||...:.  ::|:.::....:.|..:|:..|.:...:..|:......|.:..
  Fly   479 ATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATAS 543

  Fly   391 TSANSKSSRSHAVFQIVLRSAAGEKLH---GKFSLIDLAGNERGADNSSADRQTRL-EGSEINKS 451
            |:.|.:|||||||.::.|.....||..   |..:|:||||:|      |....||: |...||:|
  Fly   544 TAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSE------SPKTSTRMTETKNINRS 602

  Fly   452 LLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYAD 516
            |..|...|.||.::..|:|:|.||||.:|..| :||.. ||.|...:||.....:.::.:||:|.
  Fly   603 LSELTNVILALLQKQDHIPYRNSKLTHLLMPS-LGGNS-KTLMFINVSPFQDCFQESVKSLRFAA 665

  Fly   517 RVKELSVESIPSKRMPDANLGSTSMSDIVCQSSTQ 551
            .|.  |.:...:||       :..:::.|..||||
  Fly   666 SVN--SCKMTKAKR-------NRYLNNSVANSSTQ 691

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 109/403 (27%)
Kinesin 193..520 CDD:278646 107/383 (28%)
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 101/346 (29%)
KISc 348..678 CDD:214526 103/357 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122348361
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.