DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Kif19A

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_996208.1 Gene:Kif19A FlyBaseID:FBgn0038205 Length:750 Species:Drosophila melanogaster

Alignment Length:498 Identity:153/499 (31%)
Similarity:237/499 (47%) Gaps:88/499 (18%)


  Fly   171 SQRVRSGTTNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHE-----PRKHVNLV 230
            |.:.||..|.:.....:::|.||.||  ..|..:|..:|:|..|   |:..:     ||:     
  Fly    19 SSQGRSIATAQPAQEERLVVAVRVRP--SMEATERCIEVISGGS---LLYDDGGKSRPRQ----- 73

  Fly   231 KFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRH 295
                   :.:|:||.|..|...||:.|..||::.:.:|..|..||||.||||||:||.|..|.:.
  Fly    74 -------YSYDHVFRENDSQEQVYKTTTAPLVRDVLNGLNAAVFAYGATGSGKTHTMLGPVPRKK 131

  Fly   296 QSSMD------------------GIYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLL 342
            ..:.|                  |:...|.:|:||.:::.  ...:.:|..|:.|||...:.|||
  Fly   132 PQTSDRAPPTASCDSTDVSSQDIGLMVRAIEDIFSHIESA--EAYSCRVSISYLEIYNELIRDLL 194

  Fly   343 MPGKPQLRVLED-RNQQVQVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQI 406
            .||.| |.:.|| |.|::.|.||::....:..||:.||..||..||...|:||..||||||:..|
  Fly   195 NPGGP-LELREDHRGQRITVAGLSEITTSSRKEVVSLLLKGNKARTMEPTAANQTSSRSHALLSI 258

  Fly   407 VL--RSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRL-EGSEINKSLLVLKECIRALGRQSSH 468
            ::  |:..|.| .|:..|.||||:||.  ..:.:|..|| ||:.||:|||.|...|..|...:.:
  Fly   259 MVQARTPLGTK-QGRLFLTDLAGSERA--KKTKNRGKRLQEGAHINRSLLALGNVINGLSGGARY 320

  Fly   469 LPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKELSVESIPS----- 528
            :.:|.||||::|:::..|  :.||.|||.::|.....:.|.|||.||||...::.:...|     
  Fly   321 VNYRDSKLTRLLKEALSG--RCKTVMIAHVAPESKHRDETKNTLVYADRANSITTKLQNSVYIDE 383

  Fly   529 -KRMPDANLGS--TSMSDIVCQSSTQRL------------FPCASS----TSMPGGGNQAQQHTN 574
             |..|..:..|  :.:.|.|.:..|:.|            ...|:|    |:..|.|::|.|..:
  Fly   384 FKDFPTKHYQSLVSELRDEVSRLRTKMLTERPRSGAAAAAAAAAASGSAGTAGSGAGSEAVQEQD 448

  Fly   575 TANDLNRSQKPTS-----KPTYPTSGQQLVQRKGSSQREASMM 612
                   .|:.|.     :....|..||:..|:...:.|:.::
  Fly   449 -------EQRKTELRYLREQIVLTFKQQMKLRRKLLEAESHLL 484

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 127/359 (35%)
Kinesin 193..520 CDD:278646 125/354 (35%)
Kif19ANP_996208.1 Motor_domain 35..371 CDD:277568 127/361 (35%)
Kinesin 41..371 CDD:278646 125/355 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122347666
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.