DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Klp68D

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001261726.1 Gene:Klp68D FlyBaseID:FBgn0004381 Length:784 Species:Drosophila melanogaster

Alignment Length:460 Identity:143/461 (31%)
Similarity:214/461 (46%) Gaps:65/461 (14%)


  Fly   169 MESQRVRSGTTNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFL 233
            |.::..|.||.:.:.....:.|.||.||:..:|.::|..:||:        |:..|..|.|...:
  Fly     1 MSAKSRRPGTGSSQTPNECVQVVVRCRPMSNRERSERSPEVVN--------VYPNRGVVELQNVV 57

  Fly   234 ENHS-----FRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPG 293
            :.:.     |.:|..:|...:..|:|.....||:..:.:|.....|||||||:|||:||.|.   
  Fly    58 DGNKEQRKVFTYDAAYDASATQTTLYHEVVFPLVSSVLEGFNGCIFAYGQTGTGKTFTMEGV--- 119

  Fly   294 RHQSSMDGIYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQ 358
            |....:.||.....:.::..:...  ......|..|:.|||...:.|||.|....|.|.| |...
  Fly   120 RGNDELMGIIPRTFEQIWLHINRT--ENFQFLVDVSYLEIYMEELRDLLKPNSKHLEVRE-RGSG 181

  Fly   359 VQVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGE----KLHGK 419
            |.|..|.....::..:::.::::||..||.|.|:.|..||||||:|.|.:.....|    |: ||
  Fly   182 VYVPNLHAINCKSVEDMIKVMQVGNKNRTVGFTNMNEHSSRSHAIFMIKIEMCDTETNTIKV-GK 245

  Fly   420 FSLIDLAGNER-GADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDS 483
            .:||||||:|| ....:||:|..  |.|:||.:|..|...|.||...|.|:|:|.||||::|:||
  Fly   246 LNLIDLAGSERQSKTGASAERLK--EASKINLALSSLGNVISALAESSPHVPYRDSKLTRLLQDS 308

  Fly   484 FIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQS 548
             :||.. ||.|||.|.|..::...||.|||||.|.|.:..:.|.::...||.|..       .|.
  Fly   309 -LGGNS-KTIMIANIGPSNYNYNETLTTLRYASRAKSIQNQPIKNEDPQDAKLKE-------YQE 364

  Fly   549 STQRLFPCASSTSMPGGGNQAQQHTNTANDLNRSQKPTSKPTYPTSGQQLVQRKGSSQREASMML 613
            ..:||....        |.|.||         ||:|            |:..:|...::.....:
  Fly   365 EIERLKRLI--------GPQQQQ---------RSEK------------QVTAKKQRVKKPKKETV 400

  Fly   614 TKSLA 618
            ||.::
  Fly   401 TKEMS 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 120/342 (35%)
Kinesin 193..520 CDD:278646 119/337 (35%)
Klp68DNP_001261726.1 Motor_domain 18..344 CDD:277568 121/345 (35%)
KISc 20..351 CDD:214526 122/350 (35%)
GBP_C <479..576 CDD:303769
coiled coil 547..558 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122348686
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.