DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Klp67A

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001286999.1 Gene:Klp67A FlyBaseID:FBgn0004379 Length:814 Species:Drosophila melanogaster

Alignment Length:366 Identity:123/367 (34%)
Similarity:192/367 (52%) Gaps:35/367 (10%)


  Fly   188 IMVCVRKRPLRRKELADREQDVVSIPSKHTLV--------------VHEPRKHVNLVKFLENHSF 238
            |.|.||.||...:||..:::.::.:..:..|:              ..:|.:.:. .:..:..:.
  Fly     9 IKVAVRVRPYNVRELEQKQRSIIKVMDRSALLFDPDEEDDEFFFQGAKQPYRDIT-KRMNKKLTM 72

  Fly   239 RFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIY 303
            .||.|||.:.||..::|....||:..:.:|...:.|.||.||:|||:||.|      ..:..|:.
  Fly    73 EFDRVFDIDNSNQDLFEECTAPLVDAVLNGYNCSVFVYGATGAGKTFTMLG------SEAHPGLT 131

  Fly   304 AMAAKDVFSTLKT-VPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQN 367
            .:..:|:|..::. ....|.::.|  |:.|:|...|.:||....| |::.|| |..|.|.||...
  Fly   132 YLTMQDLFDKIQAQSDVRKFDVGV--SYLEVYNEHVMNLLTKSGP-LKLRED-NNGVVVSGLCLT 192

  Fly   368 PVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLR---SAAGEKLHGKFSLIDLAGNE 429
            |:.:..|:|.:|.||||.||...|.||::||||||:||:.:|   .....|...|.|:|||||:|
  Fly   193 PIYSAEELLRMLMLGNSHRTQHPTDANAESSRSHAIFQVHIRITERKTDTKRTVKLSMIDLAGSE 257

  Fly   430 RGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCM 494
            |.|.......:.: ||:.||||||.|..||..|.....|:|:|.|.||::|:|| :|| ..:|.|
  Fly   258 RAASTKGIGVRFK-EGASINKSLLALGNCINKLADGLKHIPYRDSNLTRILKDS-LGG-NCRTLM 319

  Fly   495 IAMISPCLHSVEHTLNTLRYADRVKELSV---ESIPSKRMP 532
            :|.:|....:.|.|.|||:||.|.|::..   :::...:||
  Fly   320 VANVSMSSLTYEDTYNTLKYASRAKKIRTTLKQNVLKSKMP 360

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 120/349 (34%)
Kinesin 193..520 CDD:278646 118/345 (34%)
Klp67ANP_001286999.1 KISc 8..353 CDD:214526 121/358 (34%)
KISc_KIP3_like 8..346 CDD:276821 121/351 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122342957
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.