DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Klp61F

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_476818.1 Gene:Klp61F FlyBaseID:FBgn0004378 Length:1066 Species:Drosophila melanogaster

Alignment Length:470 Identity:144/471 (31%)
Similarity:226/471 (48%) Gaps:72/471 (15%)


  Fly   174 VRSGTTN---ERINCHQIMVCVRKRPLRRKELADREQDVV------SIPSKHTLVVHEPRKHVNL 229
            :..|.|:   ::.:...|.|.||.|||..:|...|..:||      .:.::|||.....:|    
  Fly     3 ISGGNTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKK---- 63

  Fly   230 VKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGR 294
                    |.||..|..|.....||.....|||:.:.:|...|.|||||||:|||:||.|.....
  Fly    64 --------FTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAE 120

  Fly   295 HQSSMD-----GIYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLL-MPGKPQLRVLE 353
            .:||.:     ||...|...:|..|:.:   ::...:..|:.|:|...:.||| .....::|:.:
  Fly   121 LKSSWEDDSDIGIIPRALSHLFDELRMM---EVEYTMRISYLELYNEELCDLLSTDDTTKIRIFD 182

  Fly   354 DRNQQVQVV--GLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVL----RSAA 412
            |..::..|:  ||.:.||.:..:|..|||.|...|.:..|..|::|||||.||.||:    ....
  Fly   183 DSTKKGSVIIQGLEEIPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVVHIRENGIE 247

  Fly   413 GEKL--HGKFSLIDLAGNERGADNSSADRQTRL-EGSEINKSLLVLKECIRALGRQSSHLPFRGS 474
            ||.:  .||.:|:||||:| ....:..::..|: |...||:|||.|...|.||..::.|:|:|.|
  Fly   248 GEDMLKIGKLNLVDLAGSE-NVSKAGNEKGIRVRETVNINQSLLTLGRVITALVDRAPHVPYRES 311

  Fly   475 KLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMPDANLGST 539
            |||::|::| :|| :.||.:||.|||....:|.||:||.||.|.|.:       :..|:.|...|
  Fly   312 KLTRLLQES-LGG-RTKTSIIATISPGHKDIEETLSTLEYAHRAKNI-------QNKPEVNQKLT 367

  Fly   540 SMSDIVCQSSTQRLFPCASSTSMPGGGNQAQQHTNTANDLNRSQKPTSKPTYPTSGQQLVQRKGS 604
            ..:  |.:..|:.:             ::.::....|.|.|...  .::.||    .::..:..|
  Fly   368 KKT--VLKEYTEEI-------------DKLKRDLMAARDKNGIY--LAEETY----GEITLKLES 411

  Fly   605 SQREAS--MMLTKSL 617
            ..||.:  |:|.|:|
  Fly   412 QNRELNEKMLLLKAL 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 124/353 (35%)
Kinesin 193..520 CDD:278646 122/348 (35%)
Klp61FNP_476818.1 KISc_BimC_Eg5 17..365 CDD:276815 127/373 (34%)
Kinesin 25..356 CDD:278646 122/349 (35%)
Microtub_bind 923..>1009 CDD:290642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122338734
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.