DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and KIF2A

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001091981.1 Gene:KIF2A HGNCID:6318 Length:744 Species:Homo sapiens

Alignment Length:581 Identity:295/582 (51%)
Similarity:373/582 (64%) Gaps:55/582 (9%)


  Fly     3 KLSIEQKIFIRRSDGRVHLAEIIKLEGGDSKLITVEWPEGHTVRGKELPLELVVLMNP------H 61
            |:.|...:.|:|||||:|.|.:..| ..|::.:||||.|....:|||:.||.:..:||      .
Human     8 KIQIGIYVEIKRSDGRIHQAMVTSL-NEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEE 71

  Fly    62 IFDSPRCSGGNAASA---------NQTASI--SPRSMKQRIA-------------------TGSL 96
            |..||......|:||         ...|||  .|.|...|:.                   .||:
Human    72 IEPSPETPPPPASSAKVNKIVKNRRTVASIKNDPPSRDNRVVGSARARPSQFPEQSSSAQQNGSV 136

  Fly    97 SPVLATAPPRQQTAPPV-REDEVVHQAERMRKERERRREAQARTRLDREQGKNEDPGNPNWEVAR 160
            |.:......:::..||. |:...|.:.|:::::||:||..|...|..|.|  :.|..|||:|:..
Human   137 SDISPVQAAKKEFGPPSRRKSNCVKEVEKLQEKREKRRLQQQELREKRAQ--DVDATNPNYEIMC 199

  Fly   161 MIRLQREQMESQRVRSGTTNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRK 225
            |||..|..::   .|..||.:.|:.|:|.||||||||.:||...::.||::||||..::||||::
Human   200 MIRDFRGSLD---YRPLTTADPIDEHRICVCVRKRPLNKKETQMKDLDVITIPSKDVVMVHEPKQ 261

  Fly   226 HVNLVKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQ 290
            .|:|.::|||.:|||||.||:...|..||.||||||::.||:.||||||||||||||||:||||.
Human   262 KVDLTRYLENQTFRFDYAFDDSAPNEMVYRFTARPLVETIFERGMATCFAYGQTGSGKTHTMGGD 326

  Fly   291 FPGRHQSSMDGIYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDR 355
            |.|::|....||||:||:|||..||...|.||.|:||.:|||||..:||||| ..|.:||||||.
Human   327 FSGKNQDCSKGIYALAARDVFLMLKKPNYKKLELQVYATFFEIYSGKVFDLL-NRKTKLRVLEDG 390

  Fly   356 NQQVQVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKF 420
            .||||||||.:..|:...:||.|:::|||.||||.||||:.||||||||||:||...  ||||||
Human   391 KQQVQVVGLQEREVKCVEDVLKLIDIGNSCRTSGQTSANAHSSRSHAVFQIILRRKG--KLHGKF 453

  Fly   421 SLIDLAGNERGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFI 485
            |||||||||||||.|||||||||||:|||||||.||||||||||...|.|||.||||||||||||
Human   454 SLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFI 518

  Fly   486 GGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKE--LSVESIPSKRMPDANLGSTSMSDI 544
             |:..:|||||.|||.:.|.|:||||||||:||||  :|...||..:      ||.|..|:
Human   519 -GENSRTCMIATISPGMASCENTLNTLRYANRVKEFGISPSDIPFSQ------GSGSRPDL 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 220/332 (66%)
Kinesin 193..520 CDD:278646 217/327 (66%)
KIF2ANP_001091981.1 KISc 223..559 CDD:214526 223/340 (66%)
KISc_KIF2_like 223..551 CDD:276818 220/332 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3177
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.