DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Khc

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_476590.1 Gene:Khc FlyBaseID:FBgn0001308 Length:975 Species:Drosophila melanogaster

Alignment Length:466 Identity:142/467 (30%)
Similarity:209/467 (45%) Gaps:69/467 (15%)


  Fly   188 IMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNAT 252
            |.|..|.|||...|.....:.||..|:.    |.|     |.:. :....:.||.||....|...
  Fly    13 IKVVCRFRPLNDSEEKAGSKFVVKFPNN----VEE-----NCIS-IAGKVYLFDKVFKPNASQEK 67

  Fly   253 VYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKTV 317
            ||...|:.::..:..|...|.||||||.||||:||.|..   ..|...||......|:|:.:..:
  Fly    68 VYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVI---GDSVKQGIIPRIVNDIFNHIYAM 129

  Fly   318 PYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLELG 382
            ..| |...:..|::|||..::.|||...|..|.|.||:|:...|.|.|:..|.:..:|.:::|.|
  Fly   130 EVN-LEFHIKVSYYEIYMDKIRDLLDVSKVNLSVHEDKNRVPYVKGATERFVSSPEDVFEVIEEG 193

  Fly   383 NSVRTSGHTSANSKSSRSHAVFQIVLRSAAGE---KLHGKFSLIDLAGNER----GADNSSADRQ 440
            .|.|....|:.|..|||||:||.|.::....|   ||.||..|:||||:|:    ||:.:..|  
  Fly   194 KSNRHIAVTNMNEHSSRSHSVFLINVKQENLENQKKLSGKLYLVDLAGSEKVSKTGAEGTVLD-- 256

  Fly   441 TRLEGSEINKSLLVLKECIRALG-RQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHS 504
               |...|||||..|...|.||. ...:|:|:|.||||::|::| :|| ..:|.::...||...:
  Fly   257 ---EAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQES-LGG-NARTTIVICCSPASFN 316

  Fly   505 VEHTLNTLRYADRVK----------ELSVES----IPSKRMPDANL----------------GST 539
            ...|.:||.:..|.|          ||:.|.    ...::..:|.|                |.|
  Fly   317 ESETKSTLDFGRRAKTVKNVVCVNEELTAEEWKRRYEKEKEKNARLKGKVEKLEIELARWRAGET 381

  Fly   540 -------SMSDIVCQSSTQRLFPCASSTSMPGGGNQAQQHTNTANDLNRSQKPTSKPTYPTSGQQ 597
                   :|.|:: ::||..|...|:.|:..... .|.|.|..|| ::.|.....:....|..::
  Fly   382 VKAEEQINMEDLM-EASTPNLEVEAAQTAAAEAA-LAAQRTALAN-MSASVAVNEQARLATECER 443

  Fly   598 LVQRKGSSQRE 608
            |.|:......|
  Fly   444 LYQQLDDKDEE 454

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 117/339 (35%)
Kinesin 193..520 CDD:278646 116/345 (34%)
KhcNP_476590.1 KISc_KHC_KIF5 10..333 CDD:276820 118/341 (35%)
KISc 12..340 CDD:214526 118/348 (34%)
Apolipoprotein 595..744 CDD:279749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122341807
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.