DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and RGD1559908

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_008769700.1 Gene:RGD1559908 RGDID:1559908 Length:572 Species:Rattus norvegicus

Alignment Length:531 Identity:264/532 (50%)
Similarity:335/532 (63%) Gaps:67/532 (13%)


  Fly    67 RCSGGNA-----------ASANQTASISPRSMKQRIATGS---------------------LSPV 99
            |.:|.:|           |:|.....::|..:...:.|||                     ::.:
  Rat    51 RAAGAHAGRRGEARAHPEAAAGGERGVAPWPLSLALGTGSPEIPPPSSSSKVNKIVKNRRTVASI 115

  Fly   100 LATAPPR----------------------QQTAPPVREDEVVHQAERMRKERERRREAQARTRLD 142
            ....|||                      ||.|.  |:...|.:.|:::::||:||..|...|..
  Rat   116 KNDPPPRDNRVVGSARARPSQLPEQSSSAQQNAR--RKSNCVKEVEKLQEKREKRRLQQQELREK 178

  Fly   143 REQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNERINCHQIMVCVRKRPLRRKELADREQ 207
            |.|  :.|..|||:|:..|||..|..::   .|..||.:.|:.|:|.||||||||.:||...::.
  Rat   179 RAQ--DVDATNPNYEIMCMIRDFRGSLD---YRPLTTADPIDEHRICVCVRKRPLNKKETQMKDL 238

  Fly   208 DVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMAT 272
            ||::||||..::||||::.|:|.::|||.:|||||.||:...|..||.||||||::.||:.||||
  Rat   239 DVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPNEMVYRFTARPLVETIFERGMAT 303

  Fly   273 CFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTR 337
            ||||||||||||:||||.|.|::|....||||:||:|||..||...|.||.|:||.:|||||..:
  Rat   304 CFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFLMLKKPNYKKLELQVYATFFEIYSGK 368

  Fly   338 VFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHA 402
            ||||| ..|.:||||||..||||||||.:..|:...:||.|:::|||.||||.||||:.||||||
  Rat   369 VFDLL-NRKTKLRVLEDGKQQVQVVGLQEREVKYVEDVLKLIDIGNSCRTSGQTSANAHSSRSHA 432

  Fly   403 VFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSS 467
            ||||:||...  |||||||||||||||||||.|||||||||||:|||||||.||||||||||...
  Rat   433 VFQIILRRKG--KLHGKFSLIDLAGNERGADMSSADRQTRLEGAEINKSLLALKECIRALGRNKP 495

  Fly   468 HLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKELSVESIPSKRMP 532
            |.|||.|||||||||||| |:..:|||||.|||.:.|.|:||||||||:|.:  |...|.:.:..
  Rat   496 HTPFRASKLTQVLRDSFI-GENSRTCMIATISPGMASCENTLNTLRYANRYE--SDSYILNLKSR 557

  Fly   533 DANLGSTSMSD 543
            :|..|..:..|
  Rat   558 EARHGVVAFDD 568

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 219/332 (66%)
Kinesin 193..520 CDD:278646 215/327 (66%)
RGD1559908XP_008769700.1 KISc_KIF2_like 218..544 CDD:276818 218/330 (66%)
KISc 218..544 CDD:214526 218/330 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.