DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and cos

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001260765.1 Gene:cos FlyBaseID:FBgn0000352 Length:1201 Species:Drosophila melanogaster

Alignment Length:528 Identity:118/529 (22%)
Similarity:196/529 (37%) Gaps:138/529 (26%)


  Fly    49 ELPLELVVLMNPH--IFDSPRCSGGNAASANQTASISPRSMKQRIATGSLS-PVLATAPPRQQTA 110
            |:|:::.|.:.||  :.|..|..|          ...|:...|.:..|:.| ...|..|..::..
  Fly     2 EIPIQVAVRIFPHRELKDLLRSFG----------PTEPKKDAQAVDEGADSKDSEAQVPAAEKDN 56

  Fly   111 PPVREDEVVHQAERMRKERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVR 175
            |.:.|.:....|       |:...|.::|..|   ....|.|            |::..:|    
  Fly    57 PSISETDPNGNA-------EQDSAADSKTIPD---ANGNDSG------------QKDYPDS---- 95

  Fly   176 SGTTNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHV--NLVKFLENHSF 238
                         ..||:..|:....|        .:||  .|...:|...:  .|:: :..|:.
  Fly    96 -------------AYCVQAIPISASAL--------GLPS--ALPGGDPMDSIAAGLIQ-VGPHTV 136

  Fly   239 RFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGG--QFPGRHQSSMDG 301
            ...:......|...||..|..|||....:|..|:...|||.|.||:||:.|  |.|....|: :|
  Fly   137 PVTHALPSSSSQEQVYHQTVFPLITLFLEGFDASVVTYGQRGQGKSYTLYGNVQDPTLTDST-EG 200

  Fly   302 IYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQ 366
            :..:..:|:||.:...|.....:.|  .|.||.|..|.|||                    |:..
  Fly   201 VVQLCVRDIFSHISLHPERTYAINV--GFVEICGGDVCDLL--------------------GMGN 243

  Fly   367 NPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLR----SAAGEKLH--GKFSLIDL 425
            ....|...|...|::|.|.|         :|..:|.:|.:.|.    |..|...|  ...|..||
  Fly   244 IHCTNVDAVFHWLQVGLSAR---------QSLPAHTLFTLTLEQQWVSKEGLLQHRLSTASFSDL 299

  Fly   426 AGNERGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQ------SSHLPFRGSKLTQVLRDSF 484
            .|.||..|..        .|..::..|.:|::.|..|...      :.::|:..:.||.:|:|||
  Fly   300 CGTERCGDQP--------PGRPLDAGLCMLEQVISTLTDPGLMYGVNGNIPYGQTTLTTLLKDSF 356

  Fly   485 IGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVK---------------ELSVESIPSKRMPDA 534
              |.:.:|.:|..:||....:..||..|::|.:|:               .:.|:  |::.:|::
  Fly   357 --GGRAQTLVILCVSPLEEHLPETLGNLQFAFKVQCVRNFVIMNTYSDDNTMIVQ--PAEPVPES 417

  Fly   535 NLGSTSMS 542
            |..:..:|
  Fly   418 NSSAGPLS 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 88/348 (25%)
Kinesin 193..520 CDD:278646 86/358 (24%)
cosNP_001260765.1 Motor_domain 132..389 CDD:277568 79/299 (26%)
SPEC 657..856 CDD:295325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122348194
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.