DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and neb

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_476817.1 Gene:neb FlyBaseID:FBgn0004374 Length:1121 Species:Drosophila melanogaster

Alignment Length:577 Identity:163/578 (28%)
Similarity:248/578 (43%) Gaps:136/578 (24%)


  Fly   146 GKNEDPGNPNWEVARMIRLQREQ-MESQRVRSGTTNERINCHQIMVCVRKRPLRRKELADREQ-- 207
            |:.:.||......:|  ..:|:. |||....|..:|       ::|.||.|||...| ..|.|  
  Fly    87 GRAKTPGTGKSSCSR--TKERDSLMESCLSVSEESN-------MIVAVRVRPLNALE-CTRGQVT 141

  Fly   208 DVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVF---DEECSN----ATVYEFTARPLIKHI 265
            :||.:......:..:.....:....: .|.|.:|.|:   |.|..|    |.|:|.||||||...
  Fly   142 NVVQVHGNSNELTVQAGSSADASAGV-THFFSYDQVYYSCDPERKNFACQAKVFEGTARPLIDTA 205

  Fly   266 FDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMD--------GIYAMAAKDVFSTLKTV-PYNK 321
            |:|..|..||||||||||:|:|.| ......:::|        ||......::|..::.| ...:
  Fly   206 FEGYNACLFAYGQTGSGKSYSMMG-IEALDDAALDGGPPHDEAGIIPRFCHELFRRIEAVKSQQQ 269

  Fly   322 LNLKVYCSFFEIYGTRVFDLL-------------------MPGKPQLRVLEDRNQQVQVVGLTQN 367
            |.::|..|:||||..::.|||                   ...:|.|:|.|.......||.|:.:
  Fly   270 LQVEVEVSYFEIYNEKIHDLLSVQHAAAATGESTPIQQQQQQQRPALKVREHPIFGPYVVDLSAH 334

  Fly   368 PVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLR-------------------SAAG 413
            .|.:.:.:.:.|.:|||.|.:..|:.|.||||||::|.|||.                   |:..
  Fly   335 SVDSYSALRNWLAVGNSQRATASTAMNDKSSRSHSIFNIVLNLTDLSSDDGLSSDTDSSTASSLR 399

  Fly   414 EKLHGKFSLIDLAGNERGADNSSADRQTRLEGSEINKSLLVLKECIRAL--------------GR 464
            :....|.||:||||:||.:.:.|...:.| ||..||||||.|.:.|.||              |.
  Fly   400 QTRRSKISLVDLAGSERISVSGSNGERIR-EGVSINKSLLTLGKVIAALADSRKAIANGPLGSGT 463

  Fly   465 QSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYA-------------- 515
            .|:.:|:|.|.||.:||:: :||.. ||.|:|.|||.....:.||.|||||              
  Fly   464 PSTFVPYRESVLTWLLREN-LGGNS-KTVMLATISPASIHADETLATLRYACKARSIVNRVKVNE 526

  Fly   516 --------------DRVKELSVESIPSKRMPDANLGSTSMSDIVCQSSTQRLFPCASSTSMPGGG 566
                          ||:|.|..|....:|: ..|..:.....|:.::|       ...|.:..  
  Fly   527 SPHDKIIRDLRAEVDRLKSLRNEYERQRRL-SGNSNNPVPRKIIIETS-------VDETEVEA-- 581

  Fly   567 NQAQQHTNTANDLNRSQKPTSKPTYPTSGQ-----QLVQRKG------SSQREASMM 612
             ..||......:|:|:||...:.......|     ::::|:|      :.|::|.::
  Fly   582 -LRQQLAERERELSRAQKSWMEKLKEAEDQRKSELRVLKRRGLALELTAEQKQACLV 637

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 134/430 (31%)
Kinesin 193..520 CDD:278646 133/425 (31%)
nebNP_476817.1 KISc_KIF1A_KIF1B 119..525 CDD:276816 133/419 (32%)
KISc 120..525 CDD:214526 133/418 (32%)
Kinesin_assoc 524..657 CDD:292801 21/126 (17%)
FHA 634..740 CDD:238017 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122349511
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.