DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and KIF24

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_011516163.1 Gene:KIF24 HGNCID:19916 Length:1399 Species:Homo sapiens

Alignment Length:649 Identity:231/650 (36%)
Similarity:330/650 (51%) Gaps:126/650 (19%)


  Fly    21 LAEIIKLEGGDSKLITVEWPEGH------TVRGKELPLELVVLMNPHIFDSP------------- 66
            |.:|||:...:.|.:::  ||.|      .::.:||.......:|   ||||             
Human    88 LIKIIKIMQEEDKAVSI--PERHLQTSSLRIKSQELRSGPRRQLN---FDSPADNKDRNASNDGF 147

  Fly    67 -RCSGGNAASANQ--------------------------TASISPRSMKQRIATGSLSPVLATAP 104
             .||..: .|||:                          .|:.....::..|:|...||...:|.
Human   148 EMCSLSD-FSANEQKSTYLKVLEHMLPDDSQYHTKTGILNATAGDSYVQTEISTSLFSPNYLSAI 211

  Fly   105 PRQQTAPPVREDEVVHQAERMRKERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQM 169
            ......|.::                         |:....|.|.  |.|:    ..||    |.
Human   212 LGDCDIPIIQ-------------------------RISHVSGYNY--GIPH----SCIR----QN 241

  Fly   170 ESQRVRSGTTNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLE 234
            .|::....|..|:|.     ||||||||..:|:...|.:::::..|.||:|||.::.|:|.:::.
Human   242 TSEKQNPWTEMEKIR-----VCVRKRPLGMREVRRGEINIITVEDKETLLVHEKKEAVDLTQYIL 301

  Fly   235 NHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSM 299
            .|.|.||.||.|.|:|..||..|..|||:|||:||.||||||||||:||||||    .|.|::  
Human   302 QHVFYFDEVFGEACTNQDVYMKTTHPLIQHIFNGGNATCFAYGQTGAGKTYTM----IGTHEN-- 360

  Fly   300 DGIYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGL 364
            .|:||:||||:|..|: |...:.:|.|:.||:|||..:::|||...| :|...||....||:|||
Human   361 PGLYALAAKDIFRQLE-VSQPRKHLFVWISFYEIYCGQLYDLLNRRK-RLFAREDSKHMVQIVGL 423

  Fly   365 TQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNE 429
            .:..|.:...:|:::..|:..|::|.|..|:.|||||||.||.::.:| ::..|:.|.|||||:|
Human   424 QELQVDSVELLLEVILKGSKERSTGATGVNADSSRSHAVIQIQIKDSA-KRTFGRISFIDLAGSE 487

  Fly   430 RGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCM 494
            |.||...:||||::||:|||:|||.||||||||.::.:|.|||.|||||||:|||||  ..||||
Human   488 RAADARDSDRQTKMEGAEINQSLLALKECIRALDQEHTHTPFRQSKLTQVLKDSFIG--NAKTCM 550

  Fly   495 IAMISPCLHSVEHTLNTLRYADRVKELS-----VESIPSKRMPDANLGST-------SMSDIVCQ 547
            ||.|||...:.||||||||||||||||.     ..|:.|:.....|....       ::|:..|.
Human   551 IANISPSHVATEHTLNTLRYADRVKELKKGIKCCTSVTSRNRTSGNSSPKRIQSSPGALSEDKCS 615

  Fly   548 SSTQRLFPCASSTSMPGGGNQAQQHTNTANDLNRSQKPTSKPTYP-TSGQQLVQRKGSSQREAS 610
            ....:|....|.|....|..:.:.|..|::          .|..| ||..::..::|.|:...|
Human   616 PKKVKLGFQQSLTVAAPGSTRGKVHPLTSH----------PPNIPFTSAPKVSGKRGGSRGSPS 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 171/332 (52%)
Kinesin 193..520 CDD:278646 169/327 (52%)
KIF24XP_011516163.1 SAM_KIF24-like 34..93 CDD:188940 3/5 (60%)
KISc_KIF2_like 254..575 CDD:276818 172/337 (51%)
Kinesin 260..576 CDD:278646 169/327 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C360255688
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 1 1.000 FOG0006601
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.