DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and CG14535

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001285726.1 Gene:CG14535 FlyBaseID:FBgn0031955 Length:1131 Species:Drosophila melanogaster

Alignment Length:648 Identity:124/649 (19%)
Similarity:201/649 (31%) Gaps:244/649 (38%)


  Fly    80 ASISPRSMKQRIATGSLSPVLATAPPRQQTAPPV-------REDEVVHQAERMRKERERRREAQA 137
            |:.|..:|.:   .|.....|..|||   ..||.       ||...|.:.:.|.:..:|      
  Fly     2 ATTSTSNMSR---NGGFCGALQRAPP---PMPPTLIRRLSSRECYGVGKVKVMLRVADR------ 54

  Fly   138 RTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNERINCHQIMVCVRKRPLRRKEL 202
                ||..|..|    |::..          ::.::.:...|:.|..|........:.|:     
  Fly    55 ----DRNSGGTE----PDFMA----------LDKKKRQVTLTDPRTACPPPQAAQERAPM----- 96

  Fly   203 ADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHIFD 267
                   |:.|.                      .|.||.:|..|...:.|.......:|..:.:
  Fly    97 -------VAAPK----------------------MFAFDNLFTGEDKQSDVCASALSEVIPAVLE 132

  Fly   268 GGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKTVPYNKLNLKVYCSFFE 332
            |......|.|...:|:..|:.|:..|.     .|..:.:...|..:|...|         |:...
  Fly   133 GSDGCLLAMGYPATGQAQTVLGELGGG-----SGSGSASGSGVACSLGAAP---------CAIAW 183

  Fly   333 IYGTRVFDLLMPGKPQLRVLEDRNQ--------QVQVVG--------LTQN-------------- 367
            :|               :.:::|.|        :|..||        |:|:              
  Fly   184 LY---------------KGIQERRQKSGARFSVRVSAVGVSATKPDALSQDLLISHAAESDDSPG 233

  Fly   368 ----------PVQ---NTAEVLDLL---ELGNSVRTSGHTSANSKSSRS----------HAVFQI 406
                      |.:   .|||...|.   .|...:::||.|::.|....:          | |:|.
  Fly   234 IYLRDDFLGGPTELRAPTAERAALFLDSALAGRLKSSGSTASGSSGCAAPLESALIFTLH-VYQY 297

  Fly   407 VLRSAAG-----EKLHGKFSLIDLAGNERGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQS 466
            .|....|     .:||    :|||.|        .|:|...|..|.|...||.:....|      
  Fly   298 SLSRKGGVAGGRSRLH----IIDLGG--------CANRNGGLPLSGIGNILLAILSGQR------ 344

  Fly   467 SHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLH-----SVEHTLNTLRYADRVKEL--SVE 524
             |.|.:...||.:|:|..    ...||.:|:::   |     |.:..|:|::.|.|:..|  ...
  Fly   345 -HPPHKDHPLTPLLKDCL----APITCHVAIVA---HVRPEQSYQDALSTIQIASRIHRLRRRKH 401

  Fly   525 SIPSKRMPDA-----NLGST----------SMSDIVCQS---------STQRLFPCASSTSMPGG 565
            .:|   ||.|     .||..          |.|:|...:         :|....|.....|:..|
  Fly   402 RVP---MPLAVGLAQGLGGNGSSAGSGADPSSSEISADTVIYMGPNDDATDGEHPPVYLPSLTAG 463

  Fly   566 GNQAQQHTNTANDLNRS--QKPTSKPTYPTSGQQLVQRKGSSQREASMMLTKSLAQFRGRNFP 626
            .|:...    :..|..|  :||.||                |...:.||:.|::|..:.:..|
  Fly   464 DNRGVM----SKALKGSGLEKPPSK----------------SASNSPMMMKKAMAAEKAKKLP 506

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 74/398 (19%)
Kinesin 193..520 CDD:278646 74/393 (19%)
CG14535NP_001285726.1 Motor_domain 44..394 CDD:277568 84/464 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.