DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and nod

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001285129.1 Gene:nod FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster

Alignment Length:406 Identity:120/407 (29%)
Similarity:189/407 (46%) Gaps:44/407 (11%)


  Fly   188 IMVCVRKRPLRRKELADREQDVVSIP---SKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECS 249
            :.:.||:.|. |:.|..||..||..|   ...:|:|             :.:.|.||:.|....|
  Fly     9 VRIAVREAPY-RQFLGRREPSVVQFPPWSDGKSLIV-------------DQNEFHFDHAFPATIS 59

  Fly   250 NATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTL 314
            ...:|:....||:..:.:|...|..||||||:||:|:||...||.......||...|..|:|..:
  Fly    60 QDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERV 124

  Fly   315 KT-VPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDL 378
            .. ...||..::||.||.|||..:.|||| ...|.:.::..|.|:     .|..|:.:.|::..:
  Fly   125 TARQENNKDAIQVYASFIEIYNEKPFDLL-GSTPHMPMVAARCQR-----CTCLPLHSQADLHHI 183

  Fly   379 LELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRL 443
            ||||...|....|:.||.||||||:..|.::|   :..|.:.:::||||:| |...:..:...|.
  Fly   184 LELGTRNRRVRPTNMNSNSSRSHAIVTIHVKS---KTHHSRMNIVDLAGSE-GVRRTGHEGVARQ 244

  Fly   444 EGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHT 508
            ||..||..||.:.:.:.::....:.:|:|.|.||.||:.|......:  ..:|.|||....:..|
  Fly   245 EGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYL--TFLACISPHQCDLSET 307

  Fly   509 LNTLRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQSSTQRLFPCASSTSMPGGGNQAQQHT 573
            |:|||:....|:|.:..:...|...:           ..:.|..:|..|..||.....|.|..::
  Fly   308 LSTLRFGTSAKKLRLNPMQVARQKQS-----------LAARTTHVFRQALCTSTAIKSNAANHNS 361

  Fly   574 NTANDLNRSQKPTSKP 589
            ..   :.:|:..|:||
  Fly   362 IV---VPKSKYSTTKP 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 106/335 (32%)
Kinesin 193..520 CDD:278646 106/331 (32%)
nodNP_001285129.1 KISc 8..325 CDD:214526 108/342 (32%)
KISc 8..318 CDD:276812 106/335 (32%)
ComEA 540..648 CDD:224472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122339050
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.