DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Klp3A

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001284830.1 Gene:Klp3A FlyBaseID:FBgn0011606 Length:1212 Species:Drosophila melanogaster

Alignment Length:451 Identity:143/452 (32%)
Similarity:219/452 (48%) Gaps:83/452 (18%)


  Fly   179 TNERINCHQIMVCVRKRPLRRKEL-------ADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENH 236
            ::|..:|  :.|.:|.|||.:.||       .:|..|            ..|:..||     .|.
  Fly     2 SSEDPSC--VAVALRVRPLVQSELDRGCRIAVERSAD------------GAPQVTVN-----RNE 47

  Fly   237 SFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDG 301
            |:.::||||.:.|...::|...:..:|.:.:|...|..||||||||||||||..|.|.....: |
  Fly    48 SYTYNYVFDIDDSQKDLFETCVQAKVKKLLNGYNVTILAYGQTGSGKTYTMGTAFNGVLDDHV-G 111

  Fly   302 IYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMP---GKPQLRVLEDRNQQVQVVG 363
            :...|..|:|:.:..: .::....|.|||.|:|..:.:||...   .|..:.:.|.:| ::.:.|
  Fly   112 VIPRAVHDIFTAIAEM-QSEFRFAVTCSFVELYQEQFYDLFSSKTRDKATVDIREVKN-RIIMPG 174

  Fly   364 LTQNPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGK-------FS 421
            ||:..|.:..:|.|.|..|::.|....|:.|..||||||:|.:.|   ...||.||       |:
  Fly   175 LTELVVTSAQQVTDHLIRGSAGRAVAATAMNETSSRSHAIFTLTL---VATKLDGKQSVTTSRFN 236

  Fly   422 LIDLAGNERGADN-SSADRQTRLEGSEINKSLLVLKECIRAL--GRQSSHLPFRGSKLTQVLRDS 483
            |:||||:||.:.. :|.||..  ||..|||.||.|...|.||  |:.:.::|:|.||||::|:||
  Fly   237 LVDLAGSERCSKTLASGDRFK--EGVNINKGLLALGNVINALGSGQAAGYIPYRQSKLTRLLQDS 299

  Fly   484 FIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADR-------------------------VKELSV 523
             :||..: |.|||.:||..::|..||:|||||||                         :::|.|
  Fly   300 -LGGNSI-TLMIACVSPADYNVAETLSTLRYADRALQIKNKPVVNLDPHAAEVNMLKDVIQKLRV 362

  Fly   524 ESIPSKRMPD---ANLGSTSMSDIVCQSSTQRLFPCASSTSMPGGGNQAQQHTNTANDLNR 581
            |.:...:|..   :.:|:..:..|.|:.|      .|.|.:......:.::...|..|.||
  Fly   363 ELLSGGKMSSSLISAVGAAGLGAIPCEES------LAGSMANAAEIQRLKEQVRTLQDRNR 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 127/377 (34%)
Kinesin 193..520 CDD:278646 126/372 (34%)
Klp3ANP_001284830.1 KISc_KIF4 7..336 CDD:276823 128/358 (36%)
Kinesin 14..335 CDD:278646 126/348 (36%)
Smc <396..>994 CDD:224117 4/23 (17%)
FlaC 522..633 CDD:225888
TCR 1075..1110 CDD:281618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C122347841
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24115
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.