DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Kif2b

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001005874.2 Gene:Kif2b RGDID:1359248 Length:664 Species:Rattus norvegicus

Alignment Length:614 Identity:275/615 (45%)
Similarity:385/615 (63%) Gaps:65/615 (11%)


  Fly    10 IFIRRSDGRVHLAEIIKLEGGDSKLITVEWPEGHTVRGKELPLELVVLMNPHIFDS--------- 65
            :.|:|||.|:|||.:.:: ..::..:||||.|....:||::.||.|:|:||.:..:         
  Rat    32 VAIQRSDKRIHLAVVTEI-NRENSWVTVEWVEKGVKKGKKIELETVLLLNPALASTEHQRSRRPL 95

  Fly    66 ------PRCSGGNAASANQTASISPRSMKQRIATGSLSPVLATAPP---RQQTAPPVREDEVVHQ 121
                  |..:.|:..:|.:..::.|.  :....:|....::..:.|   :::.:|.:||      
  Rat    96 RPVSVIPATAIGDQRTATKWIAMIPH--RNETPSGDSQTLVIPSNPCLMKRKKSPCLRE------ 152

  Fly   122 AERMRKERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNERINCH 186
            .|:::|:||:||..|...|..|....|  .||||:|..|||...|..::|.::   :..|....|
  Rat   153 IEKLQKQREKRRRLQLEIRARRALDIN--TGNPNFETMRMIEEYRRHLDSSKM---SRLEPPEDH 212

  Fly   187 QIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNA 251
            :|.||||||||..:|...::.|:::|||.:.::|||.::.|:|.::|||.:|.||:.||:..||.
  Rat   213 RICVCVRKRPLNERETTMKDLDIITIPSHNVVMVHESKQKVDLTRYLENQTFCFDHAFDDTASNE 277

  Fly   252 TVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKT 316
            .||:||||||::.||..||||||||||||||||:||||.|.|:.|....||||:.|:|||..|:|
  Rat   278 LVYQFTARPLVESIFRKGMATCFAYGQTGSGKTHTMGGAFSGKAQECSKGIYALVAQDVFLLLRT 342

  Fly   317 VPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLEL 381
            ..|.||.||||.:||||||.:|:||| ..|.:|:||||.|||:|||||.:..|....|||:|:||
  Rat   343 PAYEKLELKVYGTFFEIYGGKVYDLL-NWKKKLQVLEDGNQQIQVVGLQEQEVGCVEEVLNLVEL 406

  Fly   382 GNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRLEGS 446
            |||.||||.||.|:.|||||||||::|:  .|.||||||||:||||||||||.:.|.|:.:|||:
  Rat   407 GNSCRTSGQTSVNAHSSRSHAVFQLILK--CGGKLHGKFSLVDLAGNERGADTAKATRKRQLEGA 469

  Fly   447 EINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNT 511
            |||||||.|||||||||:..||.|||.|||||||||||| |:...|||||.|||.:.|.|:||||
  Rat   470 EINKSLLALKECIRALGKNKSHTPFRASKLTQVLRDSFI-GQNSYTCMIATISPGMTSCENTLNT 533

  Fly   512 LRYADRVKELSVESIP----SKRMP------DANLGSTSMSDIVCQSSTQRLFPCASSTSMPGGG 566
            ||||:|||||::|:.|    ...||      :.|...:...|.:.|..|.:              
  Rat   534 LRYANRVKELALEARPYPPTDHEMPLTLENGNTNSEKSLQKDDIIQIPTVQ-------------- 584

  Fly   567 NQAQQHTNTANDLNRSQKPTSKPTYPTSG 595
               ::....:::|..:::|.:  ::..||
  Rat   585 ---KEEEKESDELTSTKEPAA--SWSRSG 608

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 208/332 (63%)
Kinesin 193..520 CDD:278646 205/327 (63%)
Kif2bNP_001005874.2 KISc_KIF2_like 213..541 CDD:276818 208/332 (63%)
Kinesin 219..542 CDD:278646 205/327 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.