DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and klp-7

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_001022677.1 Gene:klp-7 WormBaseID:WBGene00002219 Length:747 Species:Caenorhabditis elegans

Alignment Length:708 Identity:276/709 (39%)
Similarity:377/709 (53%) Gaps:124/709 (17%)


  Fly     4 LSIEQKIFIRRSDGRVHLAEIIKLEGGDSKLITVEWPEGHTVRGKELPLELVVLMNPHIF----- 63
            |.:...:.|:|||||:|.|.|.:::....  ..|||.|....:|||..||.::.:||.:.     
 Worm    60 LVVGMHVEIKRSDGRIHGAVIAEVKSNGR--FMVEWYEKGETKGKESSLEELLTLNPSLQAPKPT 122

  Fly    64 ---DSPRCSGGNAASANQTASISPRSM----------------------KQRIATGSLS---PVL 100
               ..|:.:...:.:.|:...|..:||                      ..:..||:.:   || 
 Worm   123 PPPQPPQKTLQASTAVNRQNGIHAQSMILDDEDTFLLDHINMIPAKGASANKRPTGAFTQHVPV- 186

  Fly   101 ATAPPRQ-----QTAPPVREDEV------------------------VHQAER------------ 124
            ..|||.:     :.||..:||..                        .|.|.|            
 Worm   187 RMAPPSEKPLPTRRAPSPKEDAAPAPKSTRTTAAFKPDLDSTAITVPKHTARRTVVVAPAPAPVP 251

  Fly   125 ------MRKERERRREAQART--RLDREQGKNE-DPGNPNWEVARMIRLQREQMESQRVRSGTTN 180
                  |..:|.....|:..:  .:.|...:.: .|.|.|:..|.|||..|.|::   .|..:..
 Worm   252 APPIANMTSQRAPSPVARVPSPKNVPRSYPQQDVQPSNGNFAFAEMIRNYRAQID---YRPLSMF 313

  Fly   181 ERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFD 245
            :.:|.::|.||||||||.:|||...|.||::|||:...::|:|:..|:|.|:|:|..|||||.||
 Worm   314 DGVNENRISVCVRKRPLNKKELTKAEVDVITIPSRDITILHQPQTRVDLTKYLDNQKFRFDYSFD 378

  Fly   246 EECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDV 310
            |..:|..||.|||.||:|.:||.|.||||||||||||||:||||.|.|:.|::..||||:.|:||
 Worm   379 EYANNELVYRFTAAPLVKTVFDNGTATCFAYGQTGSGKTHTMGGDFSGKKQNASMGIYALTARDV 443

  Fly   311 FSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEV 375
            |..|:...|.:.:|.|:|:|||||||:.:||| ..|.:||||||:.|:||||||.:....|..:|
 Worm   444 FRMLEQPQYRRKDLSVHCAFFEIYGTKTYDLL-NDKAELRVLEDKMQKVQVVGLKEEQAHNEQDV 507

  Fly   376 LDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQ 440
            |:|:..|..|||:|.||||:.||||||:|||:||.  |:|:.||||||||||||||.|....||.
 Worm   508 LELINKGTLVRTAGTTSANANSSRSHAIFQIILRQ--GKKVWGKFSLIDLAGNERGQDTRECDRD 570

  Fly   441 TRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSV 505
            ||.||:.||.|||.||||||.:.|.|||:|||.||||.||||||| |:|.:|.||:||||.:.|.
 Worm   571 TRKEGANINTSLLALKECIRGMARNSSHVPFRQSKLTMVLRDSFI-GEKSRTVMISMISPGISSS 634

  Fly   506 EHTLNTLRYADRVKEL----SVESIPSK-----RMPDANLGSTSMSDIVCQSSTQRLFPCASSTS 561
            :||||||||||||||:    |.|:.|.:     ..|.|:.......::|                
 Worm   635 DHTLNTLRYADRVKEMGTDGSGEATPIRDEELFLPPSADKSDEEYDEMV---------------- 683

  Fly   562 MPGGGNQAQQHTNTANDLNRSQKPTSKPTYPTSGQQLVQRKGSSQREASMMLTKSLAQ 619
                  :.|:|...|.|..|:.|..|:.....:...|.....::|:...:.....|||
 Worm   684 ------EKQEHRRVAVDHVRNLKDMSEKIIRETTIVLSNEPSAAQKAECLAKLDQLAQ 735

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 201/332 (61%)
Kinesin 193..520 CDD:278646 198/327 (61%)
klp-7NP_001022677.1 KISc_KIF2_like 320..648 CDD:276818 201/332 (61%)
Kinesin 326..649 CDD:278646 198/327 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C359153176
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T374727
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 1 0.910 0.833 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3177
TreeFam 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.