DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and Kif2c

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_006238694.1 Gene:Kif2c RGDID:620239 Length:722 Species:Rattus norvegicus

Alignment Length:683 Identity:299/684 (44%)
Similarity:395/684 (58%) Gaps:116/684 (17%)


  Fly     5 SIEQKIF------IRRSDGRVHLAEI--IKLEGGDSKLITVEWPEGHTVRGKELPLELVVLMNPH 61
            |:..::|      |:||:|.:|.|.|  :.||   ...::|||.||.|.:|||:.::.|..:||.
  Rat     3 SLHARLFPGLSINIQRSNGLIHSANISTVNLE---KSCVSVEWTEGGTTKGKEIDIDDVAAINPE 64

  Fly    62 IF--------DS---------------------PRCSGGNAASANQTASIS-------------- 83
            :.        ||                     |....|..:.:.:.:::|              
  Rat    65 LVQLLPLRPKDSLPLQENVTIPKQKRKSVNSKIPGPKEGLRSRSTRISTVSEVRIPAQENEMEVE 129

  Fly    84 -PRSMKQR----IATG----SLS-----PVLATAPPRQQTAPPVREDE-------------VVHQ 121
             |.|...|    |.||    |.|     |:|..:...::.|...|...             :|.:
  Rat   130 LPVSTNSRKPFPIHTGHPRPSCSTVTELPLLMISEEAEEQAHSTRSTSSANPGNSVRRKSCIVKE 194

  Fly   122 AERMRKERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNERINCH 186
            .|:|:.:||.:|...:..|:.|.|  ..|...||||.||||:..|..|:...:   |..:.|..|
  Rat   195 MEKMKNKREEKRAQNSEIRIKRAQ--EYDNSFPNWEFARMIKEFRVTMDCNPL---TVTDPIEEH 254

  Fly   187 QIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNA 251
            :|.||||||||.::|||.:|.||:|:|||..|:||||:..|:|.|:|||.:|.||:.|||..||.
  Rat   255 RICVCVRKRPLNKQELAKKEIDVISVPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNE 319

  Fly   252 TVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKT 316
            .||.||||||::.||:||.||||||||||||||:||||...|:.|::..||||||::||| .||.
  Rat   320 VVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSGKSQNASKGIYAMASRDVF-LLKN 383

  Fly   317 VP-YNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLE 380
            .| |..|||:||.:|||||..:|||||.. |.:||||||..||||||||.:..|....:|:.::.
  Rat   384 QPRYRSLNLEVYVTFFEIYNGKVFDLLNK-KAKLRVLEDSKQQVQVVGLQEYLVTCADDVIKMIN 447

  Fly   381 LGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRLEG 445
            :|::.||||.|.|||.||||||.|||:||  |..:|||||||:||||||||||.||||||||:||
  Rat   448 MGSACRTSGQTFANSNSSRSHACFQILLR--AKGRLHGKFSLVDLAGNERGADTSSADRQTRMEG 510

  Fly   446 SEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLN 510
            :|||||||.|||||||||:..:|.|||.|||||||||||| |:..:|||||||||.:.|.|:|||
  Rat   511 AEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFI-GENSRTCMIAMISPGISSCEYTLN 574

  Fly   511 TLRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQSSTQRLFPCASSTSMPGGGNQAQQHTNT 575
            ||||||||||||..|.||             .:...|..|:.:...:...|:.  ||:.::.::.
  Rat   575 TLRYADRVKELSPHSGPS-------------GEQAVQMETEEMDASSHGASLT--GNEEEELSSQ 624

  Fly   576 ANDLNRSQKPTSKPTYPTSGQQLVQRKGSSQRE 608
            .:..|.:.         |..::|.:|.....||
  Rat   625 MSSFNEAM---------TQIRELEERAMEELRE 648

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 218/333 (65%)
Kinesin 193..520 CDD:278646 215/328 (66%)
Kif2cXP_006238694.1 KISc_KIF2_like 255..583 CDD:276818 218/333 (65%)
Kinesin 261..584 CDD:278646 215/328 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C360244660
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 1 0.910 0.857 Consistency score
TreeFam 1 0.960
65.810

Return to query results.
Submit another query.