DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and KIF2C

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:NP_006836.2 Gene:KIF2C HGNCID:6393 Length:725 Species:Homo sapiens

Alignment Length:654 Identity:289/655 (44%)
Similarity:388/655 (59%) Gaps:106/655 (16%)


  Fly     1 MDKLSIEQKIF------IRRSDGRVHLAEI--IKLEGGDSKLITVEWPEGHTVRGKELPLELVVL 57
            ||. |::.::|      |:||:|.:|.|.:  :.||   ...::|||.||...:|||:..:.|..
Human     3 MDS-SLQARLFPGLAIKIQRSNGLIHSANVRTVNLE---KSCVSVEWAEGGATKGKEIDFDDVAA 63

  Fly    58 MNPHIFD-------------------------------SPRCSGGNAASANQTAS---------- 81
            :||.:..                               :|:.|..:.::...|.|          
Human    64 INPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRITAQEND 128

  Fly    82 ------ISPRSMKQ----RIATGSLSPVLATAPPR---------------QQTAPPV----REDE 117
                  .:..|.||    ...|....|.:|..|.|               ..:|.||    |:..
Human   129 MEVELPAAANSRKQFSVPPAPTRPSCPAVAEIPLRMVSEEMEEQVHSIRGSSSANPVNSVRRKSC 193

  Fly   118 VVHQAERMRKERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNER 182
            :|.:.|:|:.:||.::...:..|:.|.|  ..|...||||.||||:..|..:|...:   |..:.
Human   194 LVKEVEKMKNKREEKKAQNSEMRMKRAQ--EYDSSFPNWEFARMIKEFRATLECHPL---TMTDP 253

  Fly   183 INCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEE 247
            |..|:|.||||||||.::|||.:|.||:|||||..|:||||:..|:|.|:|||.:|.||:.|||.
Human   254 IEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDET 318

  Fly   248 CSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFS 312
            .||..||.||||||::.||:||.||||||||||||||:||||...|:.|::..||||||::||| 
Human   319 ASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSGKAQNASKGIYAMASRDVF- 382

  Fly   313 TLKTVP-YNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVL 376
            .||..| |.||.|:||.:|||||..::||||.. |.:||||||..||||||||.::.|.:..:|:
Human   383 LLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNK-KAKLRVLEDGKQQVQVVGLQEHLVNSADDVI 446

  Fly   377 DLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQT 441
            .::::|::.||||.|.|||.||||||.|||:||  |..::||||||:||||||||||.|||||||
Human   447 KMIDMGSACRTSGQTFANSNSSRSHACFQIILR--AKGRMHGKFSLVDLAGNERGADTSSADRQT 509

  Fly   442 RLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVE 506
            |:||:|||||||.|||||||||:..:|.|||.|||||||||||| |:..:|||||.|||.:.|.|
Human   510 RMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFI-GENSRTCMIATISPGISSCE 573

  Fly   507 HTLNTLRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQSSTQRLFPCASSTSMPGGGNQAQQ 571
            :|||||||||||||||..|.||             .:.:.|..|:.:..|::...:||..::.::
Human   574 YTLNTLRYADRVKELSPHSGPS-------------GEQLIQMETEEMEACSNGALIPGNLSKEEE 625

  Fly   572 HTNT 575
            ..::
Human   626 ELSS 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 216/333 (65%)
Kinesin 193..520 CDD:278646 213/328 (65%)
KIF2CNP_006836.2 Globular. {ECO:0000255} 2..254 59/260 (23%)
Microtubule tip localization signal 98..101 0/3 (0%)
Negative regulator of microtubule-binding. {ECO:0000250} 207..238 12/33 (36%)
KISc_KIF2_like 258..586 CDD:276818 216/333 (65%)
Nuclear localization signal. {ECO:0000255} 415..418 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C360243738
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.