DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and LOC105946293

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_012811276.1 Gene:LOC105946293 ID: Length:282 Species:Xenopus tropicalis

Alignment Length:35 Identity:18/36 (50%)
Similarity:24/36 (67%) Gaps:0/36 (0%)


  Fly   234 ENHSFRFDYVFDEECSNATVYEFTARPLIKHIFDG 268
            :.|:|.||.||.|..:|..||..||.|||:|:|:|
 Frog   248 DRHAFYFDEVFSETFTNQDVYMRTAYPLIQHVFNG 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 18/36 (50%)
Kinesin 193..520 CDD:278646 18/36 (50%)
LOC105946293XP_012811276.1 SAM_KIF24-like 41..99 CDD:188940
Motor_domain 237..>282 CDD:277568 17/34 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 1 1.000 FOG0006601
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.