DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and LOC105945963

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_012810513.1 Gene:LOC105945963 ID: Length:133 Species:Xenopus tropicalis

Alignment Length:133 Identity:63/134 (47%)
Similarity:88/134 (66%) Gaps:17/134 (13%)


  Fly   382 GNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRLEGS 446
            |:..|::|.:..||.|||||||.||.::::...|| |:.|.|||.|:||.:|...:|:||:|||:
 Frog     5 GSRERSTGASGVNSDSSRSHAVIQIQMKNSKNRKL-GRISFIDLTGSERASDAKESDKQTKLEGA 68

  Fly   447 EINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISP---------C- 501
            |||:|||.||||||||.::.:|.|||.||||||.|.:::      .|:|.::.|         | 
 Frog    69 EINQSLLALKECIRALDQEQAHTPFRQSKLTQVSRLNYL------CCLIPVMEPPFEGPNGSLCV 127

  Fly   502 LHS 504
            |||
 Frog   128 LHS 130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 63/134 (47%)
Kinesin 193..520 CDD:278646 63/134 (47%)
LOC105945963XP_012810513.1 Motor_domain <1..103 CDD:277568 55/99 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.