DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and LOC101731767

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_004920518.2 Gene:LOC101731767 ID: Length:563 Species:Xenopus tropicalis

Alignment Length:471 Identity:159/472 (34%)
Similarity:238/472 (50%) Gaps:100/472 (21%)


  Fly    69 SGGNAASANQTAS-ISPRSMKQRIATGSLSPVLATAP-------PRQQTAPPVREDE--VVHQAE 123
            |..|...:..||| ..||..:...::|:.:....:|.       |.:.:||.:.:.|  ::|:..
 Frog   155 SMNNPGDSVSTASPADPRYCRNIHSSGTEADTTCSAKTQNTKTLPHRGSAPDLSDGEIPIIHRVA 219

  Fly   124 RMRKERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNERINCHQI 188
            .:.  .......|...|||..:.|                  |...|:.|:|             
 Frog   220 HVL--GYNYGVPQTCRRLDPTEKK------------------RPWTETDRIR------------- 251

  Fly   189 MVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSF--------------- 238
             ||||||||..:|....|.:|||...|.|:.::|.::.|||.:::....:               
 Frog   252 -VCVRKRPLSSREERRGEVNVVSAEEKGTITIYERKEAVNLKEYILQVQYEQLTLISVEWRTPHQ 315

  Fly   239 RFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIY 303
            ::.||       .:::.|:.|         |.||||||||||:|||:||.|      .....|:|
 Frog   316 QYYYV-------NSLFTFSCR---------GNATCFAYGQTGAGKTHTMIG------TQKNPGLY 358

  Fly   304 AMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNP 368
            |:||||:|..|.||.. |.:.||:.||:|||..:::|||...| :|...||....||:.||.:..
 Frog   359 ALAAKDIFQQLATVQL-KSDCKVWISFYEIYCGQLYDLLNERK-RLYAREDGKHVVQIAGLREVQ 421

  Fly   369 VQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGAD 433
            |.:...:|:::..|:..|::|.:..||.|||||||.||.::::...|| |:.|.|||||:||.:|
 Frog   422 VSSVELLLEMILKGSRERSTGASGVNSDSSRSHAVIQIQMKNSKNRKL-GRISFIDLAGSERASD 485

  Fly   434 NSSADRQTRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMI 498
            ...:|:||:|||:|||:|||.||||||||.::.:|.|||.||||||.|.:::      .|:|.::
 Frog   486 AKESDKQTKLEGAEINQSLLALKECIRALDQEQAHTPFRQSKLTQVSRLNYL------CCLIPVM 544

  Fly   499 SP---------C-LHS 504
            .|         | |||
 Frog   545 EPPFEGPNGSLCVLHS 560

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 136/344 (40%)
Kinesin 193..520 CDD:278646 133/338 (39%)
LOC101731767XP_004920518.2 SAM_KIF24-like 41..99 CDD:188940
Motor_domain 249..533 CDD:277568 130/323 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 1 1.000 FOG0006601
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.