DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and kif24

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_012811275.1 Gene:kif24 XenbaseID:XB-GENE-855671 Length:938 Species:Xenopus tropicalis

Alignment Length:241 Identity:108/242 (45%)
Similarity:141/242 (58%) Gaps:36/242 (15%)


  Fly   382 GNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRLEGS 446
            |:..|::|.:..||.|||||||.||.::::...|| |:.|.|||||:||.:|...:|:||:|||:
 Frog     3 GSRERSTGASGVNSDSSRSHAVIQIQMKNSKNRKL-GRISFIDLAGSERASDAKESDKQTKLEGA 66

  Fly   447 EINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNT 511
            |||:|||.||||||||.::.:|.|||.|||||||:|||||..  ||||||.:||...:.||||||
 Frog    67 EINQSLLALKECIRALDQEQAHTPFRQSKLTQVLKDSFIGNS--KTCMIANVSPSHIATEHTLNT 129

  Fly   512 LRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQSSTQRLFPCAS----STSMPGGGNQ---- 568
            ||||||||||       ||      |:||      .|:..|...|.|    ..:..|.|::    
 Frog   130 LRYADRVKEL-------KR------GTTS------HSAHGRPAACVSPKRVQNAPAGSGDKISPK 175

  Fly   569 ----AQQHTNTANDLNRSQKPT-SKPT-YPTSGQQLVQRKGSSQRE 608
                .|||.:.::.......|: ..|| .|.|.......|.|:.:|
 Frog   176 KVKLGQQHISASHQAKSKSCPSVFHPTIIPLSSTPKYCSKSSTAKE 221

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 83/137 (61%)
Kinesin 193..520 CDD:278646 84/138 (61%)
kif24XP_012811275.1 Motor_domain <1..137 CDD:277568 83/137 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.