DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and kif2a

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_017946291.1 Gene:kif2a XenbaseID:XB-GENE-951755 Length:747 Species:Xenopus tropicalis

Alignment Length:541 Identity:274/542 (51%)
Similarity:349/542 (64%) Gaps:56/542 (10%)


  Fly    45 VRGKELPLELVVLMNPHIFDSPRCSGG-----------------------------NAASANQTA 80
            |..:|:.||.:..:||.:........|                             ..|..|:.|
 Frog    50 VADQEIDLESIFSLNPDLAPDEEIDPGPEMPPPPTPTTKVNKIVKNRRTVAPVKNETPARDNRVA 114

  Fly    81 SIS-----PRSMKQRIAT----GSLSPVLATAPPRQQTAPPV-REDEVVHQAERMRKERERRREA 135
            ::|     |....::.|:    ||:|.:....|.::...||. |:...|.:.|:::::||:||..
 Frog   115 AVSSARARPSQPIEQSASAQQNGSVSDISPDQPGKKDFGPPSRRKSNCVKEVEKLQEKREKRRLQ 179

  Fly   136 QARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGTTNERINCHQIMVCVRKRPLRRK 200
            |...|  .::.::.|..|||:|:..||:..|..::   .|..||.:.|:.|:|.||||||||.:|
 Frog   180 QQELR--EKKAQDVDATNPNYEIMCMIKDFRGSLD---YRPLTTADTIDEHRICVCVRKRPLNKK 239

  Fly   201 ELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYVFDEECSNATVYEFTARPLIKHI 265
            |...::.||::||||..::||||::.|:|.:||||.:|||||.|||...|..||.||||||::.|
 Frog   240 ENTVKDLDVITIPSKDVVMVHEPKQKVDLTRFLENQTFRFDYAFDETAPNEMVYRFTARPLVETI 304

  Fly   266 FDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAKDVFSTLKTVPYNKLNLKVYCSF 330
            |:.||||||||||||||||:||||.|.|::|....||||:||:|||..||...|.||.|:||.:|
 Frog   305 FERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDVFQMLKKPNYKKLELQVYATF 369

  Fly   331 FEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAEVLDLLELGNSVRTSGHTSANS 395
            ||||..:||||| ..|.:||||||..||||||||.:..|:...:||.|:|:|||.||||.||||:
 Frog   370 FEIYSGKVFDLL-NRKTKLRVLEDGKQQVQVVGLQEREVKCVEDVLKLIEIGNSCRTSGQTSANA 433

  Fly   396 KSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSADRQTRLEGSEINKSLLVLKECIR 460
            .||||||||||:||...  |||||||||||||||||||.|||||||||||:|||||||.||||||
 Frog   434 HSSRSHAVFQIILRRKG--KLHGKFSLIDLAGNERGADTSSADRQTRLEGAEINKSLLALKECIR 496

  Fly   461 ALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVKE--LSV 523
            ||||...|.|||.|||||||||||| |:..:|||||.|||.:.|.|:||||||||:||||  :|.
 Frog   497 ALGRNKPHTPFRASKLTQVLRDSFI-GENSRTCMIATISPGMASCENTLNTLRYANRVKEFGISP 560

  Fly   524 ESIPSKRMPDANLGSTSMSDI 544
            ..||..:      ||.|.||:
 Frog   561 SDIPFSQ------GSGSRSDL 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 223/332 (67%)
Kinesin 193..520 CDD:278646 220/327 (67%)
kif2aXP_017946291.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3177
TreeFam 1 0.960
65.820

Return to query results.
Submit another query.