DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and LOC100333835

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_021334897.1 Gene:LOC100333835 ID: Length:761 Species:Danio rerio

Alignment Length:626 Identity:266/627 (42%)
Similarity:346/627 (55%) Gaps:146/627 (23%)


  Fly     3 KLSIEQKIFIRRSDGRVHLAEIIKL-EGGDSKLITVEWPEGHTVRGKELPLELVVLMNP------ 60
            ::.|...:.|:|||||:|.|.:..| :..||  :||||.|....:|||:.||.|..:||      
Zfish     7 RIQIGIYVEIKRSDGRIHQAMVTSLNDHNDS--VTVEWIENGDTKGKEVDLESVFSLNPDVAPEE 69

  Fly    61 HIFDSPRCSGGNAASANQTASISPRSMKQRIATGSLSPVLATAP--------------------- 104
            .|..||.......:||.:...| |:|..:|    :::||.:..|                     
Zfish    70 EILQSPETPPPLMSSAARPNKI-PQSKNRR----AVAPVKSETPAKDNRGTLIIIMIHGRRWVCF 129

  Fly   105 ----------------------------------------------PRQQTAPPV---------- 113
                                                          |.|||.||.          
Zfish   130 GFLCFCTCPLAVVLKCVYVESACVCPNVCVTCDLPYSVTGGTTRARPSQQTEPPAAPAPPMNIQQ 194

  Fly   114 ---------REDEVVHQAERMRKERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQM 169
                     |:...|.:.|:::::||:||..|...|..|.|  ..|...||:|:..|||..|..:
Zfish   195 QTLQQQNARRKSNCVKEVEKLQEKREKRRLQQQELREKRAQ--EVDTTTPNYEIMCMIRDFRASL 257

  Fly   170 ESQRVRSGTTNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLE 234
            :   .|..||.:.|..|:|.||||.|||.:|||:.::.||::||||..::||||::.|:|.::||
Zfish   258 D---YRPLTTADLIEDHRICVCVRTRPLNKKELSMKDLDVITIPSKDVVMVHEPKQKVDLTRYLE 319

  Fly   235 NHSFRFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSM 299
            |.:|||||.||:..:|..||.||||||::.:|:.||||||||||||||||:||||.|.|::|...
Zfish   320 NQTFRFDYAFDDTSTNEMVYRFTARPLVETVFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCS 384

  Fly   300 DGIYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGL 364
            .||||:||:|||..||...|.||:|:|:.:|||||.         ||..:               
Zfish   385 KGIYALAARDVFLMLKKPIYKKLDLQVFSTFFEIYS---------GKVSV--------------- 425

  Fly   365 TQNPVQNTAEVLDLLELGN------SVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLI 423
                  :|:.:...::||:      ..||||.||||:.||||||||||::|...  |:|||||||
Zfish   426 ------HTSVLNSCVQLGDVCVCVCLCRTSGQTSANAHSSRSHAVFQIIVRRRG--KMHGKFSLI 482

  Fly   424 DLAGNERGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGK 488
            ||||||||||.|||||||||||:|||||||.||||||||||...|.|||.|||||||||||| |:
Zfish   483 DLAGNERGADTSSADRQTRLEGAEINKSLLALKECIRALGRNKPHTPFRASKLTQVLRDSFI-GE 546

  Fly   489 KVKTCMIAMISPCLHSVEHTLNTLRYADRVKE--LSVESIP 527
            ..:|||||.|||.:.|.|:||||||||:||||  :|...||
Zfish   547 NSRTCMIATISPGMASCENTLNTLRYANRVKEFGISPSDIP 587

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 194/338 (57%)
Kinesin 193..520 CDD:278646 191/333 (57%)
LOC100333835XP_021334897.1 KISc_KIF2_like 272..577 CDD:276818 194/338 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.