DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Klp59C and kif2c

Sequence 1:NP_611759.1 Gene:Klp59C FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster
Sequence 2:XP_005163529.1 Gene:kif2c ZFINID:ZDB-GENE-070912-298 Length:700 Species:Danio rerio

Alignment Length:702 Identity:275/703 (39%)
Similarity:373/703 (53%) Gaps:136/703 (19%)


  Fly     1 MDKLSIEQKIFIRRSDGRVHLAEIIKLEGGDSKLITVEWPEGHTVRGKELPL--------ELVVL 57
            :.||.|...:.|.|||||:|.| |:|........:.|||.|....:|||:.:        :|:..
Zfish     5 LSKLLIGLAVNISRSDGRIHSA-IVKTANVSKSTVNVEWAEHGMTKGKEVDMNELNHLNSDLIQH 68

  Fly    58 MNPHIFDSPRCSGGNAASANQTASISPRSM---KQRIATGSLSPVLATAPP-------------- 105
            :.|...:.|..:.........|.|:....:   ..||.|.| .|.....|.              
Zfish    69 LQPCHQEEPAPTPIPTPMTRMTKSVKASELPLRSSRIPTTS-EPAPRDCPSEEPASRRMTTRQTC 132

  Fly   106 --RQQTAPPV----REDEVVHQ------------------------------------------- 121
              ||...|||    ..|:|:.|                                           
Zfish   133 LFRQPAPPPVVSASSADDVLSQNLPSSTIPKHSGYQRRLLSKPASPLLPSTEAICESEASKCAPM 197

  Fly   122 ---AERMRKERERRREAQARTRLDR-----EQGKNEDPGNPNWEVARMIRLQREQMESQRVRSGT 178
               :.||.:..|..:.|..|..:.:     ::||..:. |.:.:..:||...||.::...:   :
Zfish   198 GPPSHRMSQVSETNKVANKRLSIAKMPDAQKRGKFGET-NRSKQFYQMIEEYRETVQKVPM---S 258

  Fly   179 TNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHSFRFDYV 243
            .::.:..|:|.||||||||.:||||.:|.|||:||....|::|||::.|:|.|:|||.:|.|||.
Zfish   259 LSDPVKTHRICVCVRKRPLNKKELAKKEIDVVTIPGNGVLLLHEPKQKVDLTKYLENQTFHFDYS 323

  Fly   244 FDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGGQFPGRHQSSMDGIYAMAAK 308
            |||:.:|..||.|||:||:|.||:|||||||||||||||||:||||.|.|:.|:|..||||:||:
Zfish   324 FDEDATNDLVYRFTAKPLVKTIFEGGMATCFAYGQTGSGKTHTMGGDFSGKSQNSSKGIYALAAQ 388

  Fly   309 DVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTA 373
            |||:.|:...|..::|..|.:|||||..:|||||.. |.:||||||..|||.||||.:.||....
Zfish   389 DVFTLLRQKRYVDMDLCPYVTFFEIYNGKVFDLLNK-KTKLRVLEDEKQQVNVVGLQEVPVSCVD 452

  Fly   374 EVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGKFSLIDLAGNERGADNSSAD 438
            :|:.::|.|::.||||.|.||:.||||||:.|::||..  ..|:|||||:||||||||.|.||.|
Zfish   453 DVIKMIERGSACRTSGQTFANASSSRSHAILQVILRRR--NFLYGKFSLVDLAGNERGTDVSSND 515

  Fly   439 RQTRLEGSEINKSLLVLKECIRALGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISPCLH 503
            |.|.:|.:|||:|||.||||||:||:.|.|:|||.|||||||||||| |:..:|||||||||.:.
Zfish   516 RHTIVETAEINRSLLALKECIRSLGQNSEHIPFRMSKLTQVLRDSFI-GENSRTCMIAMISPGMS 579

  Fly   504 SVEHTLNTLRYADRVKELSVESIPSKRMPDANLGSTSMSDIVCQSSTQRLFPCASSTSMPGGGNQ 568
            |.|:||||||||:|||||:               ..|..|.|...|...|               
Zfish   580 SCEYTLNTLRYANRVKELN---------------GISKGDAVENGSKLEL--------------- 614

  Fly   569 AQQHTNTANDLNRSQKPTSKPTYPTSGQ--QLVQR-----KGSSQREASMML 613
                   :.:.|.|::.|..|.:....:  ::.:|     ||.|:...||.|
Zfish   615 -------SEEGNSSEEETVLPEFEAISRVSEMEERFYEELKGCSEVAKSMEL 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 204/332 (61%)
Kinesin 193..520 CDD:278646 201/327 (61%)
kif2cXP_005163529.1 KISc_KIF2_like 267..595 CDD:276818 204/332 (61%)
Kinesin 273..596 CDD:278646 201/327 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D202066at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24115
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.