DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CNBP and LOC101730592

Sequence 1:NP_001188992.1 Gene:CNBP FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_017945163.1 Gene:LOC101730592 ID: Length:485 Species:Xenopus tropicalis

Alignment Length:89 Identity:27/90 (30%)
Similarity:37/90 (41%) Gaps:21/90 (23%)


  Fly    55 EKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERG 119
            ::|:||....|.|..|..:.  |..|...||:||:|.:.   .|..||..||..|.||||.:   
 Frog   206 KQCFKCGSKRHLANDCTLKV--CALCGAQGHVSKECNKV---RCNLCNDLGHTHRECPEAWH--- 262

  Fly   120 PTNVSCYKCNRTGHISKNCPETSK 143
                         :|.:.||...|
 Frog   263 -------------NIVRKCPRIEK 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 27/90 (30%)
LOC101730592XP_017945163.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.