DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and gzma

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:266 Identity:78/266 - (29%)
Similarity:116/266 - (43%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |||| |...|...:|..|..::.:|        |||.::|.::|||||||.|...|..       
Zfish    28 IVGG-KDVKKALSWMVSIQVNQNHK--------CGGILIHKEWVLTAAHCKEDSYSSV------- 76

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
                 .|.:|.|..:..:     |...:.||.:...::.:.:    |:||.|:.|.:|.:...:.
Zfish    77 -----TVLIGSLSLSKGS-----QRIAIHNYEIPETFNKKTK----KDDIMLIRLSKKVKAKPYK 127

  Fly   232 AAVCLPPDSGNDVQQVT---AAGWGFTAD--GVKSSHLLKVNLQRFSDEV-CQKRL-RFSIDTRT 289
            .     |....|||..|   ..||| |.|  |.::|..|::......|.| |.:.. |..:.|:.
Zfish   128 I-----PKKEKDVQPGTKCVVRGWG-TTDYKGKQASDKLQMLEVLVVDRVQCNRYYNRNPVITKD 186

  Fly   290 QFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYT---KVHLYTD 351
            ..|||:......||.||||||:       .|.|.::|::|....||....|:|||   |.|:  .
Zfish   187 MLCAGNTQQHRGTCLGDSGGPL-------ECEKNLVGVLSGSHGCGDPKKPTVYTLLSKRHI--T 242

  Fly   352 WIESIV 357
            ||..|:
Zfish   243 WINKIL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/263 (29%)
Tryp_SPc 102..353 CDD:214473 75/260 (29%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 77/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.