DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3700 and gzmk

Sequence 1:NP_611736.1 Gene:CG3700 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_017208551.1 Gene:gzmk ZFINID:ZDB-GENE-091204-352 Length:267 Species:Danio rerio

Alignment Length:265 Identity:75/266 (28%)
Similarity:112/266 (42%) Gaps:53/266 (20%)


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            |||| |...|...:|..|     .|.|..|   |||.::|.::|||:|.|.|...|..       
Zfish    38 IVGG-KDVKKALSWMVSI-----QKEKIHI---CGGILIHKQWVLTSAQCKEVPVSSV------- 86

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHV 231
                 .|.:|.|..:..:     |...::||.:...::.:.:|    :||.|:.|.:|.:...:.
Zfish    87 -----TVLIGSLSLSKGS-----QRIGILNYEIPKTFNEKTKE----DDIMLIRLSKKVKAKPYK 137

  Fly   232 AAVCLPPDSGNDVQQVT---AAGWGFT--ADGVKSSHLLKVNLQRFSDEVCQKRL-RFSIDTRTQ 290
            .     |.:..||...|   ..|||.|  .|...|..|..:.:.....:.|.:.. |..:.|:..
Zfish   138 I-----PKNEKDVPPGTKCVVRGWGTTDYKDEQASDKLQMLEVLVVDRDQCNRYYNRNPVITKDM 197

  Fly   291 FCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYT---KVHLYTDW 352
            .|||:......||.||||||:       .|.|.::|::|....||....|:|||   |.|:  .|
Zfish   198 LCAGNTQQHRGTCWGDSGGPL-------ECKKNLVGVISGSQGCGIPKKPTVYTFLSKRHI--SW 253

  Fly   353 IESIV 357
            |.||:
Zfish   254 INSIL 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/263 (28%)
Tryp_SPc 102..353 CDD:214473 72/260 (28%)
gzmkXP_017208551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.