DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3700 and CG11843

Sequence 1:NP_611736.1 Gene:CG3700 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster

Alignment Length:276 Identity:117/277 (42%)
Similarity:154/277 (56%) Gaps:35/277 (13%)


  Fly    86 CKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAH 150
            |:.|         ||.||||..|..:|||.||.:| .||:.| |..:|.|||.::..:|||||||
  Fly    61 CRSY---------TPLIVGGHPAQPREFPHMARLG-RRPDPS-SRADWFCGGVLISERFVLTAAH 114

  Fly   151 CLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKND 215
            |||::..:..           ||||||||::|..:||..:|:.|..|:.||||    |:..|.:|
  Fly   115 CLESERGEVN-----------VVRLGELDFDSLDEDAAPRDYMVAGYIAHPGY----EDPQFYHD 164

  Fly   216 IALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVK-SSHLLKVNLQRFSDEVCQK 279
            |.||:|.....|:.:....|||...........|.|||.|...:| |:.||||.|||:.:.||:|
  Fly   165 IGLVKLTEAVVFDLYKHPACLPFQDERSSDSFIAVGWGSTGLALKPSAQLLKVKLQRYGNWVCKK 229

  Fly   280 RLRFSI-------DTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQ 337
            .|...:       |...|.|.||..:| ||||||||||:.:.|..|||:..|:||.|.||.|||.
  Fly   230 LLTRQVEEFPRGFDGNNQLCVGSEMAQ-DTCNGDSGGPLLMYHREYPCMYVVVGITSAGLSCGSP 293

  Fly   338 GLPSVYTKVHLYTDWI 353
            |:|.:||:|:.|..||
  Fly   294 GIPGIYTRVYPYLGWI 309

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 113/261 (43%)
Tryp_SPc 102..353 CDD:214473 112/259 (43%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 113/261 (43%)
Tryp_SPc 68..309 CDD:214473 112/259 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BPQ8
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4734
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.