DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3700 and CG11670

Sequence 1:NP_611736.1 Gene:CG3700 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097767.2 Gene:CG11670 FlyBaseID:FBgn0038114 Length:404 Species:Drosophila melanogaster

Alignment Length:314 Identity:89/315 (28%)
Similarity:138/315 (44%) Gaps:41/315 (13%)


  Fly    65 PIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKS 129
            |.|..|:|..........:...:.||:............|.:..:..::|.||.:|....|   .
  Fly   106 PPPNHHRNFHNIFLNTESKVDGENYNKTAETEDLHDDFNGRSIVAPGQYPHMAALGFRNEN---H 167

  Fly   130 DINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRV 194
            :|::.||||::..:|||||||||.|..:..:           :|::|::.......:...|..||
  Fly   168 EIDYKCGGSLISEEFVLTAAHCLTTHGTSPD-----------IVKIGDIKLKEWELNVAPQRRRV 221

  Fly   195 VNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGV 259
            ....:||.|:....    .:||.|::|:|..|:...|..|.|.|.:.....::...|:|.|....
  Fly   222 AQIYLHPLYNASLN----YHDIGLIQLNRPVEYTWFVRPVRLWPMNDIPYGKLHTMGYGSTGFAQ 282

  Fly   260 KSSHLL-KVNLQRFSDEVCQKRLRFSIDT-----RTQFCAGSMSSQADTCNGDSGGPIFV----- 313
            ..:::| :::|.....|.|...|.....:     .:|.||.......|||.||||||:.:     
  Fly   283 PQTNILTELDLSVVPIEQCNSSLPADEGSPHGLLTSQICAHDYEKNRDTCQGDSGGPLQLNLERR 347

  Fly   314 -------QHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWGN 360
                   :|..|    .::||.|||..|.|: ||.|||:|..|.|||.||||.|
  Fly   348 RRRHTSRKHYRY----YLVGITSYGAYCRSE-LPGVYTRVSSYIDWIASIVWPN 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/272 (29%)
Tryp_SPc 102..353 CDD:214473 77/269 (29%)
CG11670NP_001097767.2 Tryp_SPc 145..392 CDD:238113 79/270 (29%)
Tryp_SPc 145..389 CDD:214473 77/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131167704
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.