| Sequence 1: | NP_611736.1 | Gene: | CG3700 / 37640 | FlyBaseID: | FBgn0034796 | Length: | 360 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097766.1 | Gene: | snk / 41607 | FlyBaseID: | FBgn0003450 | Length: | 435 | Species: | Drosophila melanogaster | 
| Alignment Length: | 366 | Identity: | 122/366 - (33%) | 
|---|---|---|---|
| Similarity: | 172/366 - (46%) | Gaps: | 54/366 - (14%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    22 YC----DNGTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFND--IVCCPIPLDHQNLKPAEQTR 80 
  Fly    81 PFEKQCKQYNEV---------------RSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSK-S 129 
  Fly   130 DINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRV 194 
  Fly   195 VNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTAD-G 258 
  Fly   259 VKSSHLLKVNLQRFSDEVC------QKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPL 317 
  Fly   318 YPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG3700 | NP_611736.1 | Tryp_SPc | 102..356 | CDD:238113 | 103/261 (39%) | 
| Tryp_SPc | 102..353 | CDD:214473 | 100/258 (39%) | ||
| snk | NP_001097766.1 | CLIP | 93..139 | CDD:197829 | 9/47 (19%) | 
| Tryp_SPc | 186..430 | CDD:238113 | 103/261 (39%) | ||
| Tryp_SPc | 186..427 | CDD:214473 | 100/258 (39%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 119 | 1.000 | Inparanoid score | I4773 | 
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D105391at6960 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.970 | |||||