DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and snk

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001097766.1 Gene:snk / 41607 FlyBaseID:FBgn0003450 Length:435 Species:Drosophila melanogaster


Alignment Length:366 Identity:122/366 - (33%)
Similarity:172/366 - (46%) Gaps:54/366 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YC----DNGTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFND--IVCCPIPLDHQNLKPAEQTR 80
            :|    |..:|.|  :....|..:.....:.|..:..|...|:  ::|||:...|...:....|:
  Fly    92 FCRRSFDGRSGYC--ILAYQCLHVIREYRVHGTRIDICTHRNNVPVICCPLADKHVLAQRISATK 154

  Fly    81 PFEKQCKQYNEV---------------RSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSK-S 129
                 |::||..               :....|.|.|||||......||.||.:|..:.:.|| .
  Fly   155 -----CQEYNAAARRLHLTDTGRTFSGKQCVPSVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQ 214

  Fly   130 DINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRV 194
            ||.|.|||::|...:||||||| .|..||          |..:||||....|.|:  |..||.::
  Fly   215 DIKWGCGGALVSELYVLTAAHC-ATSGSK----------PPDMVRLGARQLNETS--ATQQDIKI 266

  Fly   195 VNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTAD-G 258
            :..|:||.|    ....:.:||||::|.|:.:|::.|...||.......:..|.|||||.|.. |
  Fly   267 LIIVLHPKY----RSSAYYHDIALLKLTRRVKFSEQVRPACLWQLPELQIPTVVAAGWGRTEFLG 327

  Fly   259 VKSSHLLKVNLQRFSDEVC------QKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPL 317
            .||:.|.:|:|.......|      ::||...| ...|||||.:....|||.|||||||....|.
  Fly   328 AKSNALRQVDLDVVPQMTCKQIYRKERRLPRGI-IEGQFCAGYLPGGRDTCQGDSGGPIHALLPE 391

  Fly   318 YPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358
            |.|:..|:||.|:|..|.:...|.|||:::.|.||||.|.:
  Fly   392 YNCVAFVVGITSFGKFCAAPNAPGVYTRLYSYLDWIEKIAF 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 103/261 (39%)
Tryp_SPc 102..353 CDD:214473 100/258 (39%)
snkNP_001097766.1 CLIP 93..139 CDD:197829 9/47 (19%)
Tryp_SPc 186..430 CDD:238113 103/261 (39%)
Tryp_SPc 186..427 CDD:214473 100/258 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.