DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3700 and CG4998

Sequence 1:NP_611736.1 Gene:CG3700 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster

Alignment Length:334 Identity:101/335 (30%)
Similarity:148/335 (44%) Gaps:87/335 (26%)


  Fly    75 PAEQ-----TRPFEKQCKQYNE--------------------VRSACQST-----PFIVGGTKAS 109
            |.||     .||.||.|: .||                    ||:|...|     |..|.|....
  Fly   882 PKEQRAYYGNRPVEKTCR-INEVCCRRPLRPQAPPQQFGRCGVRNAAGITGRIKNPVYVDGDSEF 945

  Fly   110 GKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVR 174
            | |:|:...|....|.:|    .:.|||:::..:.:::||||:::..        .||   ..||
  Fly   946 G-EYPWHVAILKKDPKES----IYACGGTLIDAQHIISAAHCIKSQN--------GFD---LRVR 994

  Fly   175 LGELDYNSTTDDALVQDFRVVNYVVHPGY--DTEDEEQGFKNDIALVELDRKAEF--NDHVAAVC 235
            |||.|.|...:.....:..||:..:||.|  .|.|      ||:|:::||:..:|  |.|::..|
  Fly   995 LGEWDVNHDVEFFPYIERDVVSVHIHPEYYAGTLD------NDLAVLKLDQPVDFTKNPHISPAC 1053

  Fly   236 LPPDSGNDV--QQVTAAGWGFTADGV--KSSHLLK-VNLQRFSDEVCQKRLRFSIDTRTQF---- 291
            | ||..:|.  .:....|||..|.|.  |..::|| |::...|.:.|:.:||   :||..:    
  Fly  1054 L-PDKYSDFTGARCWTTGWGKDAFGEHGKYQNILKEVDVPILSHQQCESQLR---NTRLGYSYKL 1114

  Fly   292 -----CAGSMSSQADTCNGDSGGPIFVQHPLYPC----LKQVIGIVSYGLVCGSQGLPSVYTKVH 347
                 |||....: |.|.||.|||:.       |    ...|:|:||:|:.||...:|.||.||.
  Fly  1115 NPGFVCAGGEEGK-DACKGDGGGPLV-------CDRNGAMHVVGVVSWGIGCGQVNVPGVYVKVS 1171

  Fly   348 LYTDWIESI 356
            .|..||:.|
  Fly  1172 AYLPWIQQI 1180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/276 (31%)
Tryp_SPc 102..353 CDD:214473 84/273 (31%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 83/272 (31%)
Tryp_SPc 942..1177 CDD:214473 82/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48069
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.