DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3700 and teq

Sequence 1:NP_611736.1 Gene:CG3700 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_648288.2 Gene:teq FlyBaseID:FBgn0023479 Length:2792 Species:Drosophila melanogaster

Alignment Length:265 Identity:87/266 (33%)
Similarity:125/266 (47%) Gaps:43/266 (16%)


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            :|.|..|.....|:.|.|.|.  .:.....:| ||..|:..:.:|||||||             :
  Fly  2547 VVRGNVAQRGRHPWQATIRTR--GRGGISSHW-CGAVVISKRHLLTAAHCL-------------Y 2595

  Fly   167 DSPK--FVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQG--FKNDIALVELDRKAEF 227
            .|||  :.||:|: .|.:..:.:.|..| :.|:.:|     |:..:|  ..||||||.|....:|
  Fly  2596 GSPKGAYFVRVGD-HYANIAESSEVDSF-IENWYLH-----ENFRKGTHMNNDIALVVLKTPLKF 2653

  Fly   228 NDHVAAVCLPPDSGNDVQ--QVTAAGWGFTADGVK--SSHLLKVNLQRFSDEVC-QKRLRFSIDT 287
            :|:|..:|||..:...|:  :.|.:|||....||.  :..|....|...:|.|| |..:..|..:
  Fly  2654 SDYVQPICLPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMS 2718

  Fly   288 RTQFCAGSMSSQADTCNGDSGGPIFVQ----HPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHL 348
            ...||||||....|.|.||||||:...    ..||       |::|:|..||.:..|.||.:|:.
  Fly  2719 EGMFCAGSMDESVDACEGDSGGPLVCSDDDGETLY-------GLISWGQHCGFKNRPGVYVRVNH 2776

  Fly   349 YTDWI 353
            |.|||
  Fly  2777 YIDWI 2781

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 87/266 (33%)
Tryp_SPc 102..353 CDD:214473 86/264 (33%)
teqNP_648288.2 CBM_14 65..115 CDD:279884
ChtBD2 136..184 CDD:214696
ChtBD2 215..261 CDD:214696
ChtBD2 284..327 CDD:214696
CBM_14 521..569 CDD:279884
ChtBD2 608..654 CDD:214696
ChtBD2 709..752 CDD:214696
CBM_14 782..830 CDD:279884
ChtBD2 864..909 CDD:214696
CBM_14 942..993 CDD:279884
RCR <1051..1126 CDD:304939
RCR <1116..1210 CDD:304939
ChtBD2 1324..1369 CDD:214696
ChtBD2 1474..1518 CDD:214696
LDLa 2193..2222 CDD:238060
SR 2229..2331 CDD:214555
SRCR 2234..2332 CDD:278931
LDLa 2337..2370 CDD:197566
SR 2382..2480 CDD:214555
SRCR 2386..2480 CDD:278931
Tryp_SPc 2546..2781 CDD:214473 86/264 (33%)
Tryp_SPc 2547..2784 CDD:238113 87/266 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.