DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3700 and Ser7

Sequence 1:NP_611736.1 Gene:CG3700 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster

Alignment Length:399 Identity:107/400 (27%)
Similarity:153/400 (38%) Gaps:102/400 (26%)


  Fly    26 GTGECKELTPSDCPVIFYN----QHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQC 86
            |.|.|.|  ..||.  ||.    ..|...:..:..:..|:||||   ...|:.|     |...:.
  Fly    35 GRGTCIE--KKDCD--FYAVDKLMELASKQQCFSRQRPDLVCCP---RETNIIP-----PLAPRI 87

  Fly    87 KQYNEVRSACQST-----------------------PF--------IVGGTKASGKEFPFMALIG 120
            .  |...:|..||                       |:        :|||......|||:..|:.
  Fly    88 S--NGTTNATSSTTTLKLLPRTTPRPPSGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLE 150

  Fly   121 THRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTD 185
            ....:..|   ::.||.|.:..:::||||||:.|       :..|..:    ..|||  :|..||
  Fly   151 YETVSGGK---DYACGASFIAQRWLLTAAHCIHT-------MGRNLTA----AILGE--WNRDTD 199

  Fly   186 DALVQDFRVVNYVVHPGY---------DTEDEEQGFKNDIALVELDRKAEF--NDHVAAVCLPPD 239
            .....|...|.....|..         ..:..|..::|||||:.|.|...:  ..::..|||||.
  Fly   200 PDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQMQNLEPVCLPPQ 264

  Fly   240 SGNDVQQVT-----AAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTR-----TQFCAG 294
            .|....|:.     .:|||.|.....|....|..|.....:.||:  .|..||:     :|.|||
  Fly   265 RGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQDQCQE--AFYKDTKITLADSQMCAG 327

  Fly   295 SMSSQADTCNGDSGGPIFVQ-------HPLYPCLKQVIGIVSYGLV-CGSQGLPSVYTKVHLYTD 351
            . ....|:|:||||||:.|:       ..:|     :.|:||.|.. ||:.....:||:|..|.|
  Fly   328 G-EIGVDSCSGDSGGPLTVEANTASGNRYVY-----LAGVVSIGRKHCGTALFSGIYTRVSSYMD 386

  Fly   352 WIESIVWGN 360
            ||||.:..|
  Fly   387 WIESTIRAN 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/283 (30%)
Tryp_SPc 102..353 CDD:214473 81/280 (29%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829 13/43 (30%)
Tryp_SPc 131..388 CDD:214473 81/281 (29%)
Tryp_SPc 133..391 CDD:238113 84/282 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47699
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24258
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.