DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and F9

DIOPT Version :10

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:114 Identity:23/114 - (20%)
Similarity:45/114 - (39%) Gaps:23/114 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GSILIIDMDGIHLGHLPKLGIFTLKDLLYFIQEGLPIRLKGLHLANVVPFIDRI----------- 201
            ||.::.|.|.:.:|.|.......:...:..:.:..||...|.|..:|..::|.|           
Human    69 GSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGDYTKAFLI 133

  Fly   202 -----MTMIRPFMKKELLEMLHLHTKMHTLFPYIPQHLLPSDYGDNLYN 245
                 |.:::...:.||:.:|.:....|.      :.:|.| .||.|::
Human   134 NGYTSMDLLKKIWELELINVLKISLIGHR------KRILAS-LGDRLHD 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 23/114 (20%)
F9NP_000124.1 GLA 28..92 CDD:214503 6/22 (27%)
EGF_CA 93..129 CDD:238011 7/35 (20%)
FXa_inhibition 134..170 CDD:464251 7/42 (17%)
Tryp_SPc 227..457 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.