DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3700 and LOC101733035

Sequence 1:NP_611736.1 Gene:CG3700 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_004918261.1 Gene:LOC101733035 ID: Length:326 Species:Xenopus tropicalis

Alignment Length:305 Identity:83/306 (27%)
Similarity:122/306 (40%) Gaps:75/306 (25%)


  Fly    76 AEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVV 140
            |::.....|.|.:....||.      ||||..:...:.|:..::...:.         .|||:::
 Frog    21 AKEDAKLSKACGKPVVDRSR------IVGGQDSKEGQHPWQVIVMLPKV---------QCGGTLI 70

  Fly   141 HPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNST--------TDDALVQDFRVVNY 197
            ..:||||||.|:.:.:...           |.|.||.  ||.|        ....::.|    .|
 Frog    71 SSRFVLTAASCVHSVKDVL-----------FHVVLGA--YNLTEWTGFYVAVSRTIIHD----RY 118

  Fly   198 VVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDV--QQVTAAGWGFT-ADGV 259
             ::|.|         .:||||:||.....|...:...|||..|...:  ......|||.| .|..
 Frog   119 -IYPNY---------YDDIALLELSVSVPFTGLMLPACLPTASTQFLPGHSCIMTGWGDTDYDNS 173

  Fly   260 KSSHLL-------KVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPL 317
            ....|:       .::|:|..|...|..:..: ||.|  ||..:..:|..|.||.|||:.     
 Frog   174 NQMQLILQEAEVQLISLERCRDLYSQTNILIA-DTMT--CAMDIHEKAGICAGDLGGPLV----- 230

  Fly   318 YPCLKQ----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358
              |.|.    ::|:||.||.|.: .||.|||.|.:|.|||...|:
 Frog   231 --CQKGGQWFLVGVVSLGLNCVA-ALPVVYTSVPVYMDWINKHVF 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/276 (28%)
Tryp_SPc 102..353 CDD:214473 76/273 (28%)
LOC101733035XP_004918261.1 Tryp_SPc 40..267 CDD:214473 76/280 (27%)
Tryp_SPc 41..270 CDD:238113 77/276 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.