DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: EMC8-9 and Emc9

Sequence 1:NP_611731.1 Gene:EMC8-9 FlyBaseID:FBgn0034791 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_149158.1 Gene:Emc9 MGIID:1934682 Length:206 Species:Mus musculus

Alignment Length:202 Identity:82/203 (40%)
Similarity:110/203 (54%) Gaps:19/203 (9%)


  Fly     1 MCDYKVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSKGSQVEIVDAIPLFHQCLYVTPMAEVALM 65
            |.:.::|.|||.|:..||::|||.||||||||..|..|..:.:.|.:||||..|.::.|.||||.
Mouse     1 MGEVEISARAYGKMCLHASRYPHAAVNGLLLAPATGSGECLCLTDCVPLFHSHLALSVMLEVALN 65

  Fly    66 LIDAHAEREGLVIAGYYAAPENFYDNQV--DKTP---AAKIADKIQENFKNACFVVVDN-KLMTL 124
            .:|....:.|||:||||.|      |.|  |::|   |.|||.:|.|.|..|..:::|| ||:|.
Mouse    66 QVDVWGAQAGLVVAGYYHA------NAVLDDQSPGPLALKIAGRIAEFFPRAVLIMLDNKKLVTR 124

  Fly   125 QHDRAAIQVFNCPGDSGARWSKAKFTLSQASDTLEG---VSLLLKRGAMRDLVDFDNHLDNPDKN 186
            ......|.:.|    .|.:|......|....|..|.   |..||:..|.:.|||||.|||:..::
Mouse   125 PRVPPVIVLEN----QGLQWVPKDKNLVMWRDWEESRQMVGALLEGRAHQHLVDFDCHLDDIRQD 185

  Fly   187 WTNDFLN 193
            |||..||
Mouse   186 WTNQRLN 192

Known Domains:


GeneSequenceDomainRegion External IDIdentity
EMC8-9NP_611731.1 UPF0172 3..188 CDD:281640 77/194 (40%)
Emc9NP_149158.1 MPN_UPF0172 6..188 CDD:163691 78/192 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C169933552
eggNOG 1 0.900 E1_KOG3289
Hieranoid 1 1.000
Homologene 1 1.000 H41095
Inparanoid 1 1.050 124 1.000 Inparanoid score I4656
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1284861at2759
OrthoFinder 1 1.000 FOG0002120
OrthoInspector 1 1.000 T617101
orthoMCL 1 0.900 OOG5_129067
Panther 1 1.100 O PTHR12941
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4556
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.