DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: EMC8-9 and EMC8

Sequence 1:NP_611731.1 Gene:EMC8-9 FlyBaseID:FBgn0034791 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_006058.1 Gene:EMC8 HGNCID:7864 Length:210 Species:Homo sapiens

Alignment Length:214 Identity:80/215 (37%)
Similarity:106/215 (49%) Gaps:38/215 (18%)


  Fly     5 KVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSKGSQ-----------VEIVDAIPLFHQCLYVTP 58
            |::.:||.|::.|.|||||.||||||:|||.....:           ...||.|||||..|.:.|
Human     5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAP 69

  Fly    59 MAEVALMLIDAHAEREGLVIAGYYAAPENFYD---NQVDKTPAAKIADKIQENFKNACFVVVDNK 120
            |.||||.|||:..:....||||||.|.|...|   |||    |.|:|.:|.|.|.:...::|||.
Human    70 MLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQV----AEKVASRIAEGFSDTALIMVDNT 130

  Fly   121 LMTLQHDRAAIQVF-------NCPG---DSGARWSKAKFTLSQASDTLEGVSLLLKRGAMRDLVD 175
            ..|:......|.|:       .|..   |....|.:|: .:|.:         ||...:...|||
Human   131 KFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQ-RISAS---------LLDSRSYETLVD 185

  Fly   176 FDNHLDNPDKNWTNDFLNQ 194
            ||||||:...:|||..:|:
Human   186 FDNHLDDIRNDWTNPEINK 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
EMC8-9NP_611731.1 UPF0172 3..188 CDD:281640 77/207 (37%)
EMC8NP_006058.1 MPN_UPF0172 6..199 CDD:163691 77/207 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C169934976
eggNOG 1 0.900 E1_KOG3289
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4725
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1284861at2759
OrthoFinder 1 1.000 FOG0002120
OrthoInspector 1 1.000 T610298
orthoMCL 1 0.900 OOG5_129067
Panther 1 1.100 LDO PTHR12941
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4556
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.